KEGG   Pongo abelii (Sumatran orangutan): 100173314Help
Entry
100173314         CDS       T01416                                 

Gene name
TMSB4X
Definition
thymosin beta 4, X-linked
Orthology
K05764  
thymosin, beta 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100173314 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagagacgcaagagaaaaatccactgccttccaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system