KEGG   Pongo abelii (Sumatran orangutan): 100173314Help
Entry
100173314         CDS       T01416                                 

Gene name
TMSB4X
Definition
(RefSeq) thymosin beta-4
  KO
K05764  thymosin, beta 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100173314 (TMSB4X)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     100173314 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin WH2 DUF4522
Motif
Other DBs
NCBI-GeneID: 100173314
NCBI-ProteinID: NP_001126333
Ensembl: ENSPPYG00000020127
UniProt: Q5R7H8 A0A2J8W4K5
Position
X
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagagacgcaagagaaaaatccactgccttccaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system