KEGG   Pongo abelii (Sumatran orangutan): 100173315Help
Entry
100173315         CDS       T01416                                 

Gene name
AP2B1
Definition
adaptor-related protein complex 2, beta 1 subunit
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100173315 (AP2B1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100173315 (AP2B1)
  Nervous system
   04721 Synaptic vesicle cycle
    100173315 (AP2B1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100173315 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQASIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADESLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQVGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtatttcacaaccaataaaaaaggagaaatatttgaactaaaagct
gaactcaacaatgaaaagaaagaaaagagaaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgttagttctctctttccagacgtagtgaactgtatgcagact
gacaatctggaactaaagaagcttgtgtatctctacttgatgaactatgccaagagtcag
ccagacatggccatcatggctgtaaacagctttgtgaaggactgtgaagatcctaatcct
ttgattcgagccttggcagtcagaaccatggggtgcatccgggtagataaaattacagaa
tatctctgtgagccgctccgcaagtgcttgaaggatgaggatccctatgttcggaaaaca
gcagcagtctgtgtggcaaaactccatgatatcaatgcccaaatggtggaagatcaggga
tttctggattctctacgggatctcatagcagattcaaatccaatggtggtggctaatgcc
gtagcagcattatctgaaatcagtgagtctcacccaaacagcaacttacttgatctgaac
ccacagaacattaataagctgttgacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgatcgggaggctcagagcatc
tgtgagcgggtaactccccggctatcccatgccaactcagcagtggtgctttcagcggta
aaagtcctaatgaagtttctagaattgttacctaaggattctgactactacaatatgctg
ctgaagaagttagcccctccacttgtcactttgctgtctggggagccagaagtgcagtat
gtcgccctgaggaacatcaacttaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaagtcttttttgtgaagtacaatgatcccatctatgttaaactagagaagttggac
atcatgattcgtttggcatctcaagccagcattgctcaggttctggcagaactgaaagaa
tatgctacagaggtggatgttgactttgttcgaaaagctgtgcgggccattggacggtgt
gccatcaaggtggagcaatctgcagagcgctgtgtaagcacattgcttgatctaatccag
accaaagtgaattatgtggtccaagaagcaattgttgtcatcagggacatcttccgcaaa
taccccaacaagtatgaaagtatcattgccactctatgtgagaacttagactcgctggat
gagccagatgctcgagcagctatgatttggattgtgggagaatatgctgaaagaattgac
aatgcagatgagtcactagaaagcttcctggagggttttcacgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccatcagaaacacag
gagctagtccagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaactgaccctgtcacagctaaagaagta
gtcttgtctgagaagccactgatctctgaggagacagaccttattgagccaactctgctg
gatgagctaatctgccacattggttctttggcctctgtgtatcataagcctcccaatgct
tttgtggaaggaagtcatggaattcatcgtaaacacttgccaattcatcatgggagcact
gatgcaggtgacagccctgttggcactaccactgcaacgaacctggaacagcctcaggtt
atcccctctcaaggtgatcttctaggggatcttttaaaccttgacctcggtcccccagtc
aacgtgccacaggtgtcctccatgcaggtgggagcagtggatctcctaggaggaggacta
gatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtgggacaa
tccttcatcccatcatcggtgcctgcaacctttgctccttcacctacacctgctgtggtc
agcagtggactgaatgacctgtttgaactctccacagggataggcatggcacccggtgga
tatgtggctcctaaggctgtctggctacctgcagtaaaggctaaaggcttggagatttca
ggaacatttactcaccgccaagggcacatctatatggaaatgaacttcaccaataaagct
ctgcagcacatgacagattttgcaatccagtttaacaaaaatagctttggtgtcatcccc
agcactcctctggccatccatacaccactgatgccaaaccagagcattgatgtctccctg
cctctcaatactttgggcccagtcatgaagatggaacctctgaataacctccaggtggct
gtgaaaaacaatatcgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggagcgccaggtcttccttgcaacgtggaaggatattcccaat
gaaaacgaacttcagtttcagattaaggaatgtcatttaaatgctgacactgtttccagc
aagttgcaaaacaacaatgtttatactattgccaagaggaatgtggaagggcaggacatg
ctgtaccaatccctgaagctcactaatggcatttggattttggccgaactacgtatccag
ccgggaaaccccaattacacgctgtcactgaagtgtagagctcctgaagtctctcaatac
atctatcaggtctacgacagcattctgaaaaactaa

DBGET integrated database retrieval system