KEGG   Pongo abelii (Sumatran orangutan): 100173315Help
Entry
100173315         CDS       T01416                                 

Gene name
AP2B1
Definition
adaptor-related protein complex 2, beta 1 subunit
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pon04144]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:pon04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:pon04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:pon05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQASIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADESLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQVGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtatttcacaaccaataaaaaaggagaaatatttgaactaaaagct
gaactcaacaatgaaaagaaagaaaagagaaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgttagttctctctttccagacgtagtgaactgtatgcagact
gacaatctggaactaaagaagcttgtgtatctctacttgatgaactatgccaagagtcag
ccagacatggccatcatggctgtaaacagctttgtgaaggactgtgaagatcctaatcct
ttgattcgagccttggcagtcagaaccatggggtgcatccgggtagataaaattacagaa
tatctctgtgagccgctccgcaagtgcttgaaggatgaggatccctatgttcggaaaaca
gcagcagtctgtgtggcaaaactccatgatatcaatgcccaaatggtggaagatcaggga
tttctggattctctacgggatctcatagcagattcaaatccaatggtggtggctaatgcc
gtagcagcattatctgaaatcagtgagtctcacccaaacagcaacttacttgatctgaac
ccacagaacattaataagctgttgacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgatcgggaggctcagagcatc
tgtgagcgggtaactccccggctatcccatgccaactcagcagtggtgctttcagcggta
aaagtcctaatgaagtttctagaattgttacctaaggattctgactactacaatatgctg
ctgaagaagttagcccctccacttgtcactttgctgtctggggagccagaagtgcagtat
gtcgccctgaggaacatcaacttaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaagtcttttttgtgaagtacaatgatcccatctatgttaaactagagaagttggac
atcatgattcgtttggcatctcaagccagcattgctcaggttctggcagaactgaaagaa
tatgctacagaggtggatgttgactttgttcgaaaagctgtgcgggccattggacggtgt
gccatcaaggtggagcaatctgcagagcgctgtgtaagcacattgcttgatctaatccag
accaaagtgaattatgtggtccaagaagcaattgttgtcatcagggacatcttccgcaaa
taccccaacaagtatgaaagtatcattgccactctatgtgagaacttagactcgctggat
gagccagatgctcgagcagctatgatttggattgtgggagaatatgctgaaagaattgac
aatgcagatgagtcactagaaagcttcctggagggttttcacgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccatcagaaacacag
gagctagtccagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaactgaccctgtcacagctaaagaagta
gtcttgtctgagaagccactgatctctgaggagacagaccttattgagccaactctgctg
gatgagctaatctgccacattggttctttggcctctgtgtatcataagcctcccaatgct
tttgtggaaggaagtcatggaattcatcgtaaacacttgccaattcatcatgggagcact
gatgcaggtgacagccctgttggcactaccactgcaacgaacctggaacagcctcaggtt
atcccctctcaaggtgatcttctaggggatcttttaaaccttgacctcggtcccccagtc
aacgtgccacaggtgtcctccatgcaggtgggagcagtggatctcctaggaggaggacta
gatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtgggacaa
tccttcatcccatcatcggtgcctgcaacctttgctccttcacctacacctgctgtggtc
agcagtggactgaatgacctgtttgaactctccacagggataggcatggcacccggtgga
tatgtggctcctaaggctgtctggctacctgcagtaaaggctaaaggcttggagatttca
ggaacatttactcaccgccaagggcacatctatatggaaatgaacttcaccaataaagct
ctgcagcacatgacagattttgcaatccagtttaacaaaaatagctttggtgtcatcccc
agcactcctctggccatccatacaccactgatgccaaaccagagcattgatgtctccctg
cctctcaatactttgggcccagtcatgaagatggaacctctgaataacctccaggtggct
gtgaaaaacaatatcgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggagcgccaggtcttccttgcaacgtggaaggatattcccaat
gaaaacgaacttcagtttcagattaaggaatgtcatttaaatgctgacactgtttccagc
aagttgcaaaacaacaatgtttatactattgccaagaggaatgtggaagggcaggacatg
ctgtaccaatccctgaagctcactaatggcatttggattttggccgaactacgtatccag
ccgggaaaccccaattacacgctgtcactgaagtgtagagctcctgaagtctctcaatac
atctatcaggtctacgacagcattctgaaaaactaa

DBGET integrated database retrieval system