KEGG   Pongo abelii (Sumatran orangutan): 100173411Help
Entry
100173411         CDS       T01416                                 

Gene name
JOSD1, Josephin-1
Definition
Josephin domain containing 1 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRTDV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgtgccatggaaaggagacaaggccaaatctgaatcattggagctgccccag
gcagcacccccacaaatctaccatgagaaacagcgcagggagctttgtgccctccacgcc
ctcaataacgtcttccaggacagcaatgccttcacccgggatacgctgcaagagattttc
cagaggttgtctccaaacaccatggtgacacctcacaagaagagcatgctgggaaatggc
aactacgatgtgaatgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggatgtcggtgtcattgccctcactaacgtcatgggcttcatcatg
aatctgccctccagcctatgctggggtccactgaaactgcccctcaaaaggcagcactgg
atctgtgttcgagaggtgggaggggcctactacaacctcgactccaaactcaagatgccc
gagtggattggaggcgagagcgagctcaggaagtttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtaccagaagaggtagaggctcatcagagttggaggacc
gatgtgtaa

DBGET integrated database retrieval system