KEGG   Pongo abelii (Sumatran orangutan): 100173411Help
Entry
100173411         CDS       T01416                                 

Gene name
JOSD1
Definition
(RefSeq) josephin-1
  KO
K15235  josephin [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100173411 (JOSD1)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C86
   100173411 (JOSD1)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    100173411 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Josephin
Motif
Other DBs
NCBI-GeneID: 100173411
NCBI-ProteinID: NP_001126428
Ensembl: ENSPPYG00000011826
UniProt: Q5R739 A0A2J8UWL6
Position
22
AA seq 202 aa AA seqDB search
MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRTDV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtgtgccatggaaaggagacaaggccaaatctgaatcattggagctgccccag
gcagcacccccacaaatctaccatgagaaacagcgcagggagctttgtgccctccacgcc
ctcaataacgtcttccaggacagcaatgccttcacccgggatacgctgcaagagattttc
cagaggttgtctccaaacaccatggtgacacctcacaagaagagcatgctgggaaatggc
aactacgatgtgaatgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggatgtcggtgtcattgccctcactaacgtcatgggcttcatcatg
aatctgccctccagcctatgctggggtccactgaaactgcccctcaaaaggcagcactgg
atctgtgttcgagaggtgggaggggcctactacaacctcgactccaaactcaagatgccc
gagtggattggaggcgagagcgagctcaggaagtttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtaccagaagaggtagaggctcatcagagttggaggacc
gatgtgtaa

DBGET integrated database retrieval system