KEGG   Pongo abelii (Sumatran orangutan): 100173462Help
Entry
100173462         CDS       T01416                                 

Gene name
UGP2
Definition
UDP-glucose pyrophosphorylase 2 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100173462 (UGP2)
   00052 Galactose metabolism
    100173462 (UGP2)
   00500 Starch and sucrose metabolism
    100173462 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    100173462 (UGP2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100173462 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2A
AA seq 497 aa AA seqDB search
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGP
SVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIG
VRDENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQS
RYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSN
IDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVP
KAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETA
VGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVK
LGGSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPG
AVLENKIVSGNLRILDH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatggcgcttctcagttccaagaagtcattcggcaagagctagaattatct
gtgaagaaggaactagaaaaaatactcaccacagcatcatcacatgagtttgagcacacc
aaaaaagacctggatggatttcggaagctatttcatagatttttgcaagaaaaggggcct
tctgtggattggggaaaaatccagagaccccctgaagattcaattcaaccctatgaaaag
ataaaggccaggggcttgcctgataatatatcttctgtgttgaacaaactagtggtggtg
aaactcaatggtggtttgggaaccagcatgggctgcaaaggccctaaaagtctgattggt
gtgagggatgagaatacctttctggatctgactgttcagcaaattgaacatttgaataaa
acctacaatacagatgttcctcttgttttaatgaactcttttaacacggatgaagatacc
aaaaaaatactacagaagtacaatcattgtcgtgtgaaaatctatactttcaatcaaagc
aggtacccaaggattaataaagaatctttacttcctgtagcaaaggacgtgtcttactca
ggggaaaatacagaagcttggtaccctccaggtcatggtgatatttacgccagtttctac
aactctggtttgcttgatacctttataggagaaggcaaagagtatatttttgtgtctaac
atagataatctgggtgccacagtggatctgtatattcttaatcatctaatgaacccaccc
aatggaaaacgctgtgaatttgtcatggaagtcacaaataaaacacgtgcagatgtaaag
ggtgggacactgactcaatatgaaggcaaactgagactggtggaaattgctcaagtgcca
aaagcacatgtagatgagttcaagtccgtatcaaagttcaaaatatttaatacaaacaac
ctatggatttctcttgcagcagttaaaagactgcaggagcaaaatgccattgacatggaa
atcattgtgaatgcaaagactttggatggaggcctgaatgtcattcaattagaaactgca
gtaggggctgccatcaaaagttttgagaattctctaggtattaatgtgccaaggagccgt
tttctgcctgtcaaaaccacatcagatctcttgctggtgatgtcaaacctctatagtctt
aatgcaggatctctgacaatgagtgaaaagcgggaatttcctacagtgcccttggttaaa
ttaggcggttcttttacaaaggttcaagattatctaagaagatttgaaagtataccagat
atgcttgaattggaccacctcacagtttcaggagatgtgacatttggaaaaaatgtttca
ttaaagggaacggttatcatcattgcaaatcatggtgacagaattgatatcccacctgga
gcagtattagagaacaagattgtatctggaaaccttcgcatcttggaccactga

DBGET integrated database retrieval system