KEGG   Pongo abelii (Sumatran orangutan): 100173488Help
Entry
100173488         CDS       T01416                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1 (EC:1.2.1.41 2.7.2.11)
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pon01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pon00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 795 aa AA seqDB search
MLSQVYRYGFQPFNQHLLPWVQCTTISRSHCIQPSVIRHVRSWSNIPFITVPLSRTHGKS
FAHRSELKQAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRMLATLEPEQRAEIIHRLADLLTDQRDEILLANKKDLEEAEGRLAP
PLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTRE
EVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTENENTAEFFLQHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSL
KYLHENLPIPQRNTN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtcaagtttaccgctatgggttccagcccttcaaccaacatctcctgccctgg
gtccagtgtacaaccatctccagatctcattgtatccagccttcagtcatcagacatgtt
cgttcttggagcaacatcccctttatcactgtacccctcagtcgtacacatggcaagtcc
tttgcccaccgcagtgagctgaagcaggccaagagaatcgtggtgaagctcggcagtgcc
gtggtgacccgaggggatgaatgtggcctggccctggggcgcttggcatctattgttgag
caggtatcagtgctgcagaatcagggcagagagatgatgctggtgaccagtggagccgta
gcctttggcaaacaacgcttgcgccatgagatccttctgtctcagagcgtgcggcaggcc
ctccactcagggcagaaccagctgaaagaaatggcaattccagtcttagaggcacgagcc
tgtgcagctgccggacagagtgggctgatggccttgtatgaggctatgtttacccagtac
agcatctgtgctgcccagattttggtgaccaatttggatttccatgatgagcagaagcgc
cggaacctcaatggaacacttcatgaactccttagaatgaatattgtccccattgtcaac
acaaatgatgctgttgtacccccagctgagcccaacagtgacctgcagggggtaaatgtt
attagtgttaaagataatgatagcctggctgcccgactggctgtggaaatgaaaactgat
ctcttgattgttctttcagatgtagaaggcctttttgacagccccccagggtcagatgat
gcaaagcttattgatatattttatcccggagatcagcagtctgtgacatttggaaccaag
tctagagtgggaatgggtggtatggaagccaaggtgaaagcagccctctgggctttgcaa
ggtggcacttctgttgttattgccaatggaacccacccaaaggtgtctgggcacgtcatc
acagacatcgtggaggggaaaaaagttggtaccttcttttcagaagtaaagcctgcaggc
cctactgttgagcagcagggagaaatggctcgatctggaggaaggatgttggccaccttg
gaacctgagcagagagcagaaattatccatcgtctggctgatctgttgacggaccagcgt
gatgagatcctgttagccaacaaaaaagacttggaggaagcagaggggagacttgcacct
cctctgctgaaacgtttaagcctctctacatccaaattgaacagcctggccatcggtctg
cgacagatcgcagcctcctcccaggacagcgtgggacgtgttttgcgccgcacccgaatc
gccaaaaacctggaactggaacaagtgactgtcccaattggagttctgctggtgatcttt
gaatctcgtcctgactgtctaccccaggtggcagctttggctatcgcaagtggtaacggc
ttgttactcaaaggagggaaggaggctgcacacagcaaccggattctccacctcctgacc
caggaggctctctcaatccatggagtcaaggaggctgtgcagctggtgaataccagagaa
gaagttgaagatctttgccgcctagacaaaatgatagatctgattattccacgtggctct
tcccagctggtcagagacatccagaaagctgctaaggggattccagtgatggggcacagc
gaagggatctgtcacatgtatgtggattccgaggccagtgtcgataaggtcaccaggcta
gtcagagactctaaatgtgaatatccagctgcctgtaatgctttggagactttgttaatc
caccgggatctgctcaggacaccattatttgaccagatcattgatatgctgagagtggaa
caggtaaaaattcacgcaggccccaaatttgcctcctatctgaccttcagcccttccgaa
gtgaagtcactccgaactgagtatggggaccttgaattatgcattgaagtagtggacaac
gttcaggatgccattgaccacatccacaagtacggcagctcccacacggatgtcatcgtc
acagagaacgaaaacacagcggagttcttcctgcagcatgtagacagtgcctgtgtgttc
tggaatgccagcactcgcttttctgatggttaccgctttggactgggagctgaagtggga
atcagtacatcgagaatccacgcccggggaccagtaggacttgagggactgcttactact
aagtggctgctgcgagggaaggaccacgtggtctcagatttctcagagcatggaagttta
aaatatcttcatgagaacctccctattcctcagagaaacaccaactga

DBGET integrated database retrieval system