KEGG   Pongo abelii (Sumatran orangutan): 100173507Help
Entry
100173507         CDS       T01416                                 

Gene name
HDAC9
Definition
histone deacetylase 9 (EC:3.5.1.98)
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100173507 (HDAC9)
  Substance dependence
   05034 Alcoholism
    100173507 (HDAC9)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100173507 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 577 aa AA seqDB search
MLQTIYESDSCFSSDGVAGREQLLAQQRMHSMISSVDVKSEVPVGLEPISPLDLRTDLRM
MMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKLQQE
LLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVASTEVKQKLQE
FLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQNSPPLSGTSPSYKYTLPGAQDA
KDDFPLRKTESSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHAEQMVSQQRILIHE
DSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIP
ASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKFLVAGGVPLHPQSPLATKERISPG
IRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSKSIE
QLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVD
SDEDAQIQEMESGEQAAFTQQVIGKDLAPGFVIKVII
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacaatttacgagagtgactcctgtttttcctcagatggggtggctggacga
gagcagctcttggctcagcaaagaatgcacagtatgatcagctcagtggatgtgaagtca
gaagttcctgtgggcctggagcccatctcacctttagacctaaggacagacctcaggatg
atgatgcccgtggtggaccctgttgtccgtgagaagcaattgcagcaggaattacttctt
atccagcagcagcaacaaatccagaagcagctcctgatagcagaatttcagaaacagcat
gagaacttgacacggcagcaccaggctcagcttcaggagcatatcaagttgcaacaggaa
cttctagccataaaacagcaacaagaactcctagaaaaggagcagaaactggagcagcag
aggcaagaacaggaagtagagaggcatcgcagagaacagcagcttcctcctctcagaggc
aaagatagaggacgagaaagggcagtggcaagtacagaagtaaagcagaagcttcaagaa
ttcctattgagtaaatcagcaacgaaagacactccaactaatggaaaaaatcattccgtg
agccgccatcccaagctctggtacacggctgcccaccacacatcattggatcaaaactct
ccaccccttagtggaacatctccatcctacaagtacacattaccaggagcacaagatgca
aaggatgatttcccccttcgaaaaactgaatcctcagtcagtagcagttctccaggctct
ggtcccagttcaccaaacaatgggccaactggaagtgttactgaaaatgagacttcggtt
ttgccccctacccctcatgctgagcaaatggtttcacagcaacgcattctaattcatgaa
gattccatgaacctgctaagtctttatacctctccttctttgcccaacattaccttgggg
cttcccgcagtgccatcccagctcaatgcttcgaattcactcaaagaaaagcagaagtgt
gagacgcagacgcttaggcaaggtgttcctctgcctgggcagtatgggggcagcatcccg
gcatcttccagccaccctcatgttactttagagggaaagccacccaacagcagccatcag
gctctcctgcagcatttattattgaaagaacaaatgcgacagcaaaagtttcttgtagct
ggtggagttcccttacatcctcagtctcccttggcaacaaaagagagaatttcacctgga
attagaggtacccacaaattgccccgtcacagacccctgaaccgaacccagtctgcacct
ttgcctcagagcacgttggctcagctggtcattcaacagcaacaccagcaattcttggag
aagcagaagcaataccagcagcagatccacatgaacaaactgctttcgaaatctattgaa
caactgaagcaaccaggcagtcaccttgaggaagcggaggaagagcttcagggggaccag
gcgatgcaggaagacagagcgccctctagtggcaacagcactaggagcgacagcagtgct
tgtgtggatgacacactgggacaagttggggctgtgaaggtcaaggaggaaccagtggac
agtgatgaagatgctcagatccaggaaatggaatctggggagcaggctgcttttacgcaa
caggtaataggcaaagatttagctccaggatttgtaattaaagtcattatctga

DBGET integrated database retrieval system