KEGG   Pongo abelii (Sumatran orangutan): 100173558Help
Entry
100173558         CDS       T01416                                 

Gene name
PFN2, Profilin-2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100173558 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100173558 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100173558 (PFN2)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100173558 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 140 aa AA seqDB search
MAGWQSYVGNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtgggtaacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt
cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat
gtggctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system