KEGG   Pongo abelii (Sumatran orangutan): 100173619Help
Entry
100173619         CDS       T01416                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100173619 (PFKP)
   01230 Biosynthesis of amino acids
    100173619 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100173619 (PFKP)
   00030 Pentose phosphate pathway
    100173619 (PFKP)
   00051 Fructose and mannose metabolism
    100173619 (PFKP)
   00052 Galactose metabolism
    100173619 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100173619 (PFKP)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100173619 (PFKP)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100173619 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 784 aa AA seqDB search
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVCFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSSVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKETRGRGKKFTTDDSVCVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacgactcccgggcccccaagggctccttgcggaagttcctggagcacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgctcaaggtatgaac
gctgccgtccgtgccgtggtgcgcatgggtatctacgtgggggccaaggtgtgcttcatc
tatgagggctaccagggcatggtggacggaggctcgaacatcgcggaggctgactgggag
agcgtctccagcatcctgcaagtgggtgggacgatcattggcagcgcgcggtgccaggcc
ttccgcacgcgggaaggccgcctgaaggctgcctgcaacctgctgcagcgtggcatcacc
aacctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccggaaggag
tggagcgggctgctggaggagctggccaggaacggccagatcgataaggaggccgtgcag
aagtacgcctacctcaacgtggtgggcatggtgggctccatcgacaatgacttctgcggc
accgacatgaccatcggcactgactccgccctgcacaggatcattgaggttgttgacgcc
atcatgaccacggcccagagccaccagaggaccttcgttctggaggtgatgggacgacac
tgtgggtacctggccctggtgagtgccttggcctgcggtgcagactgggtgttccttcca
gaatctccgccagaggaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgt
gcccggaaaaaaaggctgaatattattattgtggccgaaggagcaattgatacccaaaat
aaacccattacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctacgataca
cgtgtgaccatcctcgggcacgtgcagagaggagggaccccttcggcattcgacaggatc
ttggccagccgcatgggagtggaggcagtcattgccttgctagaggccaccccggacacc
ccagcttgtgtcgtgtcactgaacgggaaccacgccgtgcgcctgccgctgatggagtgc
gtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagatgcggtt
cgactccgagggaggagctttgcgggcaacctgaacacctacaagcgacttgccatcaag
ctgccagatgatcagatcccaaagaccaattgcaacgtggctgtcatcaacgtgggggca
cccgcggctgggatgaacgcagccgtacgctcagctgtgcgcgttggcattgccgacggc
cacaggatgctcgccatctatgatggctttgacggcttcgccaagggccagatcaaagaa
atcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaa
cgcgttctcccggggaagtacttagaggagatcgccacacagatgcgcacgcacagcatc
aacgcgctgctgatcatcggtggatttgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggagttctgtgtccccatggtcatggttcccgctactgtgtcc
aacaatgtgccgggttccgatttcagcatcggggcagacacagccctgaacactatcacc
gacacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatc
gagaccatgggcggctactgcggctacctggccaacatgggggggctcgcggccggagct
gatgctgcatacatttttgaagagcccttcgacatcagggatctgcagtccagtgtggag
cacctgacggagaaaatgaagaccaccatccagagagggcttgtgctcagaaatgagagc
tgcagtgaaaactacaccaccgacttcatttaccagctctattcggaagagggcaaaggc
gtgtttgactgtaggaagaacgtgctgggccacatgcagcagggtggggcaccctctcca
tttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcactgcgaaa
ctcaaggagacccggggcagaggaaaaaaatttaccaccgatgattccgtttgtgtgctg
ggaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagaagcaaacggat
tttgagcacaggattcccaaagaacagtggtggctcaagctacggcccctcatgaagatc
ctggccaagtacaaggccagctacgacgtgtcggactcaggccagctggagcacgtgcag
ccctggagtgtctga

DBGET integrated database retrieval system