KEGG   Pongo abelii (Sumatran orangutan): 100173720Help
Entry
100173720         CDS       T01416                                 

Gene name
UGT1A9, DKFZP469N0814
Definition
UDP glucuronosyltransferase 1 family, polypeptide A9 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100173720 (UGT1A9)
   00053 Ascorbate and aldarate metabolism
    100173720 (UGT1A9)
   00500 Starch and sucrose metabolism
    100173720 (UGT1A9)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100173720 (UGT1A9)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100173720 (UGT1A9)
   00860 Porphyrin and chlorophyll metabolism
    100173720 (UGT1A9)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100173720 (UGT1A9)
   00982 Drug metabolism - cytochrome P450
    100173720 (UGT1A9)
   00983 Drug metabolism - other enzymes
    100173720 (UGT1A9)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100173720 (UGT1A9)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100173720 (UGT1A9)
Glycosyltransferases [BR:pon01003]
 Others
  Hydrophobic molecule
   100173720 (UGT1A9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2B
AA seq 530 aa AA seqDB search
MACTGWTSPLHLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKIYSTSYTLEDLDREFKAFAHAQWKAQVRSIFSLLMGSYNDIFDLF
FSNCRSLFKDKKLVEYLKESSFDAVFVDPFDTCGLIVAKYFSLPSVVFARGILCHYLEEG
AQCPAPLSYVPRLLLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEVLQTPVT
AYDLHSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV
IFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPPNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGIYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIIRLSSLHKDRPVEPLDLAVFWVEFVMRHEGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCFGKKGRVKKAHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcacagggtggaccagcccccttcatctatgtgtgtgtctgctgctgacctgt
ggctttgcggaggcagggaagctgctggtagtgcccatggatgggagccattggttcacc
atgcggtcggtggtggagaaactcatcctcagggggcatgaggtggttgtagtcatgcca
gaggtgagttggcaactgggaagatcactgaattgcacagtgaagatttattcaacttca
tacactctggaggatctggaccgggagttcaaggcttttgcccatgctcaatggaaagca
caagtacgaagtatattttctctattaatgggttcatacaatgacatttttgacttattt
ttttcaaattgcaggagtttgtttaaggataaaaaattagtagaatacttaaaggagagt
tcttttgatgcggtgtttgtcgatccttttgatacctgtggcttaattgttgccaaatat
ttctccctcccctccgtggtcttcgccaggggaatactttgccactatcttgaagaaggt
gcacagtgccctgcacctctttcctatgtccccagacttctcttaggattctcagatgcc
atgactttcaaggagagagtacggaaccacatcatgcacttggaggaacatttattatgc
catcgttttttcaaaaatgccctagaaatagcctctgaagttctccaaacacctgttacg
gcgtatgatctccacagccacacatcaatttggttgttgcgaacggactttgttttggac
tatcccaaacccgtgatgcccaacatgatcttcattggtggtataaactgccatcaggga
aagccagtgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
attttctctttgggatcaatggtctcagaaattccagagaagaaagccatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccaccg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtatttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagctacaaggaaaacatcatacgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggctgtgttctgggtggag
tttgtgatgaggcacgagggcgcgccacacctgcgccctgcagcccacgacctcacctgg
taccagtaccattccttggacgtgatcggtttcctcctggccgttgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttcgggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

  All links  
No link information was found.   
DBGET integrated database retrieval system