KEGG   Pongo abelii (Sumatran orangutan): 100173809Help
Entry
100173809         CDS       T01416                                 

Gene name
P4HB, PDIA1
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100173809 (P4HB)
Enzymes [BR:pon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100173809 (P4HB)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100173809 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100173809 (P4HB)
  Exosomal proteins of bladder cancer cells
   100173809 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 508 aa AA seqDB search
MLRRALLCLAVAGLVCADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALA
PEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGR
EADDIVNWLKKRTGPAATILPDGAAAESLVESSEVAVVGFFKDVESDSAKQFLQAAEAID
DIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQEL
PDDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD
DDDLEDLEEAEEPDMEEDDDQKAVKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctacgccgcgctctgctgtgcctggccgtggccggcctggtgtgcgccgacgccccc
gaggaggaggaccacgtcctggtgctgcggaaaagcaacttcgcggaggcgctggcggcc
cacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggctctggcc
cctgagtatgccaaagccgctgggaaactgaaggcagaaggttccgagatcaggttggcc
aaggtggacgccacggaggagtctgacctggcccagcagtacggcgtgcgcggctatccc
accatcaagttcttcaggaatggagacacggcttcccccaaggaatatacagctggcaga
gaggccgatgacatcgtgaactggctgaagaagcgcacgggcccggctgccaccatcctg
cctgacggcgcagctgcagagtccttggtggagtccagcgaggtggctgtcgtcggcttc
ttcaaggacgtggagtcagactctgccaagcagtttttgcaggcagcagaggccatcgat
gacataccatttgggatcacttccaacagtgacgtgttctccaaataccagctcgacaaa
gatggggttgtcctctttaagaagtttgatgaaggccggaacaactttgaaggggaggtc
accaaggagaacctgctggactttatcaaacacaaccagctgccccttgtcatcgagttc
accgagcagacagccccgaagatttttggaggtgaaatcaagactcacatcctgctgttc
ttgcccaagagtgtgtctgactatgatggcaaactgagcaacttcaaaacagcagccgag
agcttcaagggcaagatcttgttcatcttcatcgacagcgaccacaccgacaaccagcgc
atcctcgagttctttggcctaaagaaggaagagtgcccggctgtgcgcctcatcaccctg
gaggaggagatgaccaagtacaagcccgaatcggaggagctgacggcagagaggatcaca
gagttctgccaccgcttcctggagggcaaaatcaagccccacctgatgagccaggagctg
ccagacgactgggacaagcagcccgtcaaggtgcttgttgggaagaactttgaagacgtg
gcttttgatgagaaaaagaacgtctttgtggagttctatgccccatggtgtggtcactgc
aaacagttggctcccatttgggataaactaggagagacgtacaaggaccacgagaacatt
gtcatcgccaagatggactcgactgccaatgaggtggaggccgtcaaagtgcacagcttc
cccacactcaagttctttccagccagtgctgacaggacggtcatcgattacaacggggaa
cgcacgctggatggttttaagaagttcctggagagcggtggccaggatggggcaggggat
gatgacgatctcgaggacctggaagaagcagaggagccagacatggaggaagatgatgat
cagaaagctgtgaaagatgaactgtaa

DBGET integrated database retrieval system