KEGG   Pongo abelii (Sumatran orangutan): 100173814Help
Entry
100173814         CDS       T01416                                 

Gene name
RNASE1
Definition
ribonuclease, RNase A family, 1 (pancreatic) (EC:3.1.27.5)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100173814 (RNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 156 aa AA seqDB search
MALEKSLVLLPLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSGSSPNSNSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTHGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggctctggagaaatctcttgtcctgctccctctgcttgtcctgatactgctggtgctg
ggctgggtccagccttccctgggcaaagaatcccgggccaagaaattccagcggcagcac
atggactcaggcagttcccccaacagcaactccacctactgcaaccaaatgatgaggcgc
cggaatatgacacaggggcggtgcaaaccagtgaacacctttgtgcacgagcccctggta
gatgtccagaatgtctgtttccaggaaaaggtcacctgcaagaacgggcagggcaactgc
tacaagagcaactccagcatgcacatcacagactgccgcctgacacacggctccaggtac
cccaactgtgcataccggaccagcccgaaggagagacacatcattgtggcctgtgaaggg
agcccatatgtgccagtccacttcgatgcttctgtggaggactccacctaa

DBGET integrated database retrieval system