KEGG   Pongo abelii (Sumatran orangutan): 100173848Help
Entry
100173848         CDS       T01416                                 

Gene name
STAMBPL1, AMSHLP
Definition
STAM binding protein-like 1 (EC:3.1.2.15)
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100173848 (STAMBPL1)
Peptidases [BR:pon01002]
 Metallo Peptidases
  Family M67
   100173848 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 436 aa AA seqDB search
MDQPFTVNSLKKLAAMPDHTDISLSPEERVRALSKLGCNVTISEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKNDLLKKYNVEYQEYLQSKNQYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYAS
HSPPVNRALTPAATLSAVQNLVVEGLRCVVLPKDLCHKFLQLAESNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDVENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLSEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccttttactgtgaattctctgaaaaagttagctgctatgcctgaccataca
gatatttccctaagcccagaagagcgagtccgtgccctaagcaagcttggttgtaatgtc
accatcagtgaagacatcactccacgacgttactttaggtctggagtagagatggagagg
atggcgtctgtgtatttggaagaaggaaatttggaaaatgcctttgttctttataataaa
tttataaccttgtttgtagaaaagcttcctaaccatcgagattaccagcaatgtgcagta
cctgaaaagcaggatattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaacgaccttctaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aaccaatataaagctgaaattctcaaaaaactggagcatcagagattgatagaggcagaa
aggaagcggattgctcagatgcgccagcagcagctagaatcggagcagtttctgtttttc
gaagatcaactcaagaagcaagagttagcccgaggtcaaatgcgaagtcagcagacctca
gggctgtcagagcagattgatgggagcgctttgtcctgcttttccacacaccagaacaat
tccttgctgaatgtatttgcagatcaacctaataaaagtgatgcaaccaattatgctagc
cactctcctcctgtaaacagggccttaacgccagctgctactctaagtgctgttcagaat
ttagtggttgaaggactgcgatgtgtagttttgccaaaagatctttgccacaaatttctg
cagctggcagaatctaatacagtgagaggaatagaaacctgtggaatactctgtggaaaa
ctgacacataatgaatttactattacccatgtaattgtgccaaagcagtctgcaggacca
gactattgtgacgtggagaatgtagaggaattattcaatgttcaggatcaacatgatctc
ctcactctaggatggatccatacacatcccactcaaactgcatttttatccagcgttgat
cttcacactcactgttcctatcaactcatgttgtcagaggccattgccattgtttgctca
ccaaagcataaagacactggcatcttcaggctcaccaatgctggcatgcttgaggtttct
gcttgtaaaaaaaagggctttcatccacacaccaaggagcccaggctgttcagtatatgc
aaacatgtgttggtaaaagacataaaaataattgtgttggatctgaggtga

DBGET integrated database retrieval system