KEGG   Pongo abelii (Sumatran orangutan): 100173903Help
Entry
100173903         CDS       T01416                                 

Gene name
KMT2E
Definition
(RefSeq) histone-lysine N-methyltransferase 2E
  KO
K09189  histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100173903 (KMT2E)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100173903 (KMT2E)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100173903 (KMT2E)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100173903 (KMT2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD SET PHD_2
Motif
Other DBs
NCBI-GeneID: 100173903
NCBI-ProteinID: XP_002818371
Ensembl: ENSPPYG00000017888
Position
7
AA seq 1857 aa AA seqDB search
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISK
CKKAFREGSRKSSRVKGSAPEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREA
QRIALRLGNGNDKKEMNKSDLNTNNLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESMEN
INSGYETRRKKGKKDKDISKEKDTQNQNITLDCEGTTNKMKSPETKQRKLSPLRLSVSNN
QEPDFIDDIEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKTECKDTQIVSDAEVIQEQAKEENASKPTPAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDIENTVLTIEPETETALAEIITETEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDGLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKRRRKEPAENISGSCKKRWLKQALEEENSAILHRFNSPCQ
ERSRSPAVNGENKSPLLLNDSCSLPDLTTPLKKRRFYQLLDSVYSETSTPTPSPYATPTH
TDTTPMDPSFATPPRIKSDDETCRNGYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEI
KRRTYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPV
SDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTHSGRGTMYSSWVKSPDRTGVNFSV
NSNLRDLTPSHQLEVGGGFRISESKCLMQDDTRGMFMETTVFCTSEDGLVSGFGRTVNDN
LIDGSCTPQNPPQKKKVSLLEYRKRQREARKSGSKTENFPLISVSPHASGSLSTNGDGCA
SSNENGEQVEHTASLPLPTPATVYNATSEETSNNCPVKDATASEKNEPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDSGGESPCVSCSPSHVQSSPSSHSNHIPQLQAKGPVPSFSE
LMEDPDPENPEPTTTNECPSPDTSQNTCKSPSKMSKPGSPGSVIPAQAHGKIFTKPDPQW
DSTVSASEAENGVHLKTELQQKQLSNTNQALSKNHPPQTHVRNSSEQLSQKLPSAPTKLH
CPPSPHLENPPKSSTPHTPVQHGYLSPKPPSQQLGSPYRPHHSQSPQVGTPQREPQRNFY
PAAQNLQANTQQATSGTLFTQTPSGQSSATYSQFNQQSLNSTAPPPPPPPPPSSYYQNQQ
PSANFQNYNQLKGSLSQQTVFTSGPNQALPGTTSQQTVPGHHVTPGHFLPSQNPTIHHQT
AAAVVPPPPPPPPAPGPHLVQQPNSHQQHSVAHVVGPVHAVTPGSHIHSQTAGHHLPPPP
PPPGPAPHHHPPPHPSTGLQGLQAQHQHVVNSAPPPPPPPPPSSVLASGHHTTSAQALHH
PPHQGPPLFPSSAHPAVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVTGPHLQPQGPN
SIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH
NT seq 5574 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtgatcccattgggggttgatacagcagagacgtcatacttggaaatggct
gcaggttcagaaccagaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tatccccaccagttatataccagcagctcacatcattcacacagttacattggtttgccc
tatgcggaccataattatggtgctcgtcctcctccaacacctccagcttcccctcctcca
tcagtccttattagcaaaaatgaagtaggcatatttaccactcctaattttgatgaaact
tccagtgctactacaatcagcacatctgaggatggaagttatggtactgatgtaaccagg
tgcatatgtggttttacacatgatgatggatacatgatctgttgtgacaaatgcagcgtt
tggcaacatattgactgcatggggattgataggcagcatattcctgatacatatctatgt
gaacgttgtcagcctaggaatttggataaagagagggcagtgctactacaacgccggaaa
agggaaaatatgtcagatggtgataccagtgcaactgagagtggtgatgaggttcctgtg
gaattatatactgcatttcagcatactccaacgtcaattactttaactgcttcaagagtt
tccaaagttaatgataaaagaaggaaaaaaagcggggagaaagaacaacacatttcaaaa
tgtaaaaaggcatttcgtgaaggatctaggaagtcatcaagagttaaggggtcagctcca
gagattgatccttcatctgatggttcaaattttggatgggagacaaagatcaaagcatgg
atggatcgatatgaagaagcaaataacaaccagtatagtgagggtgttcagagggaggca
caaagaatagctctgagattaggcaatggaaatgacaaaaaagagatgaataaatcagat
ttgaataccaacaatttgctcttcaaacctcctgtagagagccatatacaaaagaataag
aaaattcttaaatctgcgaaagatttgcctcctgatgcacttatcattgaatacagaggg
aagtttatgctgagagaacagtttgaagcaaatgggtatttctttaaaagaccataccct
tttgtgttattctactctaaatttcatgggctagaaatgtgtgttgatgcaaggactttt
gggaatgaggctcgattcatcaggcggtcttgtacacccaatgcagaggtgaggcatgaa
attcaagatggaaccatacatctttatatttattctatacacagtattccaaagggaact
gaaattactattgcttttgattttgactatgggaattgtaagtacaaggtggactgtgca
tgcctcaaagaaaacccagagtgccctgttctaaaacgtagttctgaatccatggaaaat
atcaatagtggttatgagaccagacggaaaaaaggaaaaaaagacaaagatatttcaaaa
gaaaaagatacacaaaatcagaatattactttggattgtgaaggaacgaccaacaaaatg
aagagcccagaaactaaacaaagaaagctttctccactgagactatcagtatcaaataat
caggaaccagattttattgatgatatagaagaaaaaactcctattagtaatgaagtagaa
atggaatcagaggagcagattgcagaaaggaaaaggaagatgacaagagaagaaagaaaa
atggaagcaattttgcaagcttttgccagacttgaaaagagagagaaaagaagagaacaa
gctttggaaaggatcagcacagccaaaactgaagttaaaactgaatgtaaagatacacag
attgtcagtgatgctgaagttattcaggaacaagcaaaagaagaaaatgctagcaagcca
acccctgccaaagtaaatagaactaaacagagaaaaagtttttctcggagtaggactcac
attggacagcagcgtcggagacacagaactgtcagcatgtgttcagatatccagccatct
tctcctgatatagaagttacttcacaacaaaatgatattgaaaataccgtacttacaata
gaaccagaaactgaaactgcactagcagaaataattactgaaactgaagttccagcactt
aataaatgtcctacaaagtaccccaaaacaaagaagcacttggtcaatgaatggttaagt
gagaagaatgagaagacaggaaaaccttcagatggcctttcagaaaggcctctacgcata
actacagatcctgaagtgttagctacacaactcaattctttaccaggtctcacttacagc
ccccatgtatactctactcctaagcattatattagatttacttcaccattcctttcagaa
aaaaggagaagaaaagaacctgctgaaaacatttctggttcatgcaagaagcgatggttg
aaacaagctctggaagaagaaaattcagcaattttacatagatttaattcaccctgtcaa
gaaagatccagaagtcctgcagtcaatggtgaaaataaaagtccactactattaaatgac
agctgttcccttccagatttaactacaccactaaaaaaacgaagattttatcagttgcta
gattcggtttactcagaaacttccacacctactccttccccgtatgctacaccaactcac
accgatactactcctatggacccatcttttgccacgcctccacggataaaatcagatgat
gaaacttgtagaaatggttataaacccatatattcaccagttaccccagtaactcctggt
acaccaggaaataccatgcactttgagaatatttcttccccagaaagttctccagaaata
aagagacgcacttatagtcaagagggatatgacagatcttcaaccatgttaacattgggg
ccttttagaaattccaatttaactgaactgggtctgcaagaaataaagactattggttat
acgagccctaggagtaggactgaagtcaacaggcagtgccctggagaaaaggaacctgtg
tcagaccttcagctaggactcgatgcagttgagccaactgccctacataaaaccctggaa
acgcctgcacatgacagggctgagcccaacagccaactggactcaactcactctggacgg
ggcacaatgtattcttcctgggtaaagagccctgacagaacaggagttaacttctcagtg
aactccaacttgagggacctgacaccctcgcatcagttggaggttggaggaggcttccga
ataagtgagtcaaagtgcctgatgcaggatgatactagaggcatgtttatggaaacaact
gtgttttgtacttccgaagatgggcttgtatctggtttcggacggactgttaatgacaat
ttgatcgacgggagttgcacaccccagaatccaccacaaaagaaaaaggtttctctatta
gaataccgtaagagacaacgtgaagctaggaaaagtggctctaagacagagaactttcca
ctcattagtgtatcaccccatgcaagtggaagcttgagcaccaatggtgatggctgtgcc
agcagtaatgagaatggggagcaggtggaacacactgctagcctacctttaccaacacca
gctacagtttataatgccacttctgaagaaactagcaataactgccctgttaaggatgct
actgccagtgagaagaatgaaccagaagttcaatggactgcctcaacttcagtggaacaa
gtcagagaaaggagttatcagagagctttacttctcagtgatcaccgaaaagataaagac
agtgggggagaatcaccatgtgtctcatgttcaccgagtcatgttcagtcttcaccttca
tctcattcaaatcacataccccagttgcaagctaagggcccagtcccttctttcagtgaa
ctgatggaagaccctgatcctgaaaatccagaacccacaactacaaatgaatgtccatcc
ccagatacttctcaaaatacttgtaaaagtccttcaaaaatgagcaagcctggttcacct
ggatctgtaattcctgctcaagcacacgggaaaatattcacaaaaccagatccccaatgg
gactccacagttagtgcatccgaagctgaaaacggtgttcacctaaaaacagagctccaa
caaaaacagctatcaaataccaaccaagcactttcaaagaatcatcctcctcagacacat
gttcgtaattcatctgagcaactttcacaaaagctgccttctgcaccaacaaagttgcac
tgtcctccatcacctcacctagaaaatcctccaaagtcatccacgcctcacacacctgta
cagcatggttatctttcaccaaagcctccttcacagcagttaggatctccctacaggcct
catcattcacagtcacctcaagttggaacacctcagcgagagcctcaaagaaacttttat
ccagcagcacagaaccttcaagccaatactcagcaggcaacttctggaacattatttaca
cagacaccctcaggacaatcttcagcaacatacagtcagtttaaccaacaaagtctgaac
agcacggcaccaccccctccacctcctccacctccttcgtcttactatcaaaaccagcag
ccctctgcaaactttcagaattataatcagctcaaaggtagtctttctcaacaaactgtg
tttacatcaggaccaaatcaagcacttcctggcaccacaagccagcaaacagttccagga
caccacgtgactccagggcattttttgccctctcagaaccctaccattcaccatcaaact
gctgctgccgtagtcccccctcctccaccaccaccacctgctccaggaccgcaccttgta
caacagccgaattcccatcagcaacactctgtagcacatgtagtagggcctgttcatgcg
gtcacccctgggtcgcatattcattctcaaactgctggacaccacttacccccaccccca
ccccctcccggtcctgcccctcatcaccatccaccaccccatccttccacaggactccaa
ggtctacaagcacaacaccagcatgttgtaaattcagcacccccaccaccccctccgccg
ccaccttccagtgttttggcttctgggcatcataccacatcagctcaagccttacaccac
ccacctcatcaaggacctccactttttccttcaagtgctcatccagctgtaccaccgtat
ccctcacaagctacacatcataccactttgggaccgggaccccagcaccagccttctgga
acagggccacattgtccattacctgtcacaggtcctcatctccagccccaaggaccaaac
agtattccaacacctactgcttcagggttctgtcctcatcctggctctgtggccctgcca
catggggttcaaggacctcagcaggcatctccagtgcctggacagattccaattcacaga
gcacaggtgccaccaacatttcaaaacaattaccatgggtcagggtggcattaa

DBGET integrated database retrieval system