KEGG   Pongo abelii (Sumatran orangutan): 100173903Help
Entry
100173903         CDS       T01416                                 

Gene name
MLL5
Definition
myeloid/lymphoid or mixed-lineage leukemia 5 (trithorax homolog, Drosophila)
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pon00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1857 aa AA seqDB search
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISK
CKKAFREGSRKSSRVKGSAPEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREA
QRIALRLGNGNDKKEMNKSDLNTNNLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IQDGTIHLYIYSIHSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESMEN
INSGYETRRKKGKKDKDISKEKDTQNQNITLDCEGTTNKMKSPETKQRKLSPLRLSVSNN
QEPDFIDDIEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKTECKDTQIVSDAEVIQEQAKEENASKPTPAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDIENTVLTIEPETETALAEIITETEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDGLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKRRRKEPAENISGSCKKRWLKQALEEENSAILHRFNSPCQ
ERSRSPAVNGENKSPLLLNDSCSLPDLTTPLKKRRFYQLLDSVYSETSTPTPSPYATPTH
TDTTPMDPSFATPPRIKSDDETCRNGYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEI
KRRTYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPV
SDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTHSGRGTMYSSWVKSPDRTGVNFSV
NSNLRDLTPSHQLEVGGGFRISESKCLMQDDTRGMFMETTVFCTSEDGLVSGFGRTVNDN
LIDGSCTPQNPPQKKKVSLLEYRKRQREARKSGSKTENFPLISVSPHASGSLSTNGDGCA
SSNENGEQVEHTASLPLPTPATVYNATSEETSNNCPVKDATASEKNEPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDSGGESPCVSCSPSHVQSSPSSHSNHIPQLQAKGPVPSFSE
LMEDPDPENPEPTTTNECPSPDTSQNTCKSPSKMSKPGSPGSVIPAQAHGKIFTKPDPQW
DSTVSASEAENGVHLKTELQQKQLSNTNQALSKNHPPQTHVRNSSEQLSQKLPSAPTKLH
CPPSPHLENPPKSSTPHTPVQHGYLSPKPPSQQLGSPYRPHHSQSPQVGTPQREPQRNFY
PAAQNLQANTQQATSGTLFTQTPSGQSSATYSQFNQQSLNSTAPPPPPPPPPSSYYQNQQ
PSANFQNYNQLKGSLSQQTVFTSGPNQALPGTTSQQTVPGHHVTPGHFLPSQNPTIHHQT
AAAVVPPPPPPPPAPGPHLVQQPNSHQQHSVAHVVGPVHAVTPGSHIHSQTAGHHLPPPP
PPPGPAPHHHPPPHPSTGLQGLQAQHQHVVNSAPPPPPPPPPSSVLASGHHTTSAQALHH
PPHQGPPLFPSSAHPAVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVTGPHLQPQGPN
SIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGXRWH
NT seq 5574 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtgatcccattgggggttgatacagcagagacgtcatacttggaaatggct
gcaggttcagaaccagaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tatccccaccagttatataccagcagctcacatcattcacacagttacattggtttgccc
tatgcggaccataattatggtgctcgtcctcctccaacacctccagcttcccctcctcca
tcagtccttattagcaaaaatgaagtaggcatatttaccactcctaattttgatgaaact
tccagtgctactacaatcagcacatctgaggatggaagttatggtactgatgtaaccagg
tgcatatgtggttttacacatgatgatggatacatgatctgttgtgacaaatgcagcgtt
tggcaacatattgactgcatggggattgataggcagcatattcctgatacatatctatgt
gaacgttgtcagcctaggaatttggataaagagagggcagtgctactacaacgccggaaa
agggaaaatatgtcagatggtgataccagcgcaactgagagtggtgatgaggttcctgtg
gaattatatactgcatttcagcatactccaacgtcaattactttaactgcttcaagagtt
tccaaagttaatgataaaagaaggaaaaaaagcggggagaaagaacaacacatttcaaaa
tgtaaaaaggcatttcgtgaaggatctaggaagtcatcaagagttaaggggtcagctcca
gagattgatccttcatctgatggttcaaattttggatgggagacaaagatcaaagcatgg
atggatcgatatgaagaagcaaataacaaccagtatagtgagggtgttcagagggaggca
caaagaatagctctgagattaggcaatggaaatgacaaaaaagagatgaataaatcagat
ttgaataccaacaatttgctcttcaaacctcctgtagagagccatatacaaaagaataag
aaaattcttaaatctgcgaaagatttgcctcctgatgcacttatcattgaatacagaggg
aagtttatgctgagagaacagtttgaagcaaatgggtatttctttaaaagaccataccct
tttgtgttattctactctaaatttcatgggctagaaatgtgtgttgatgcaaggactttt
gggaatgaggctcgattcatcaggcggtcttgtacacccaatgcagaggtgaggcatgaa
attcaagatggaaccatacatctttatatttattctatacacagtattccaaagggaact
gaaattactattgcttttgattttgactatgggaattgtaagtacaaggtggactgtgca
tgcctcaaagaaaacccagagtgccctgttctaaaacgtagttctgaatccatggaaaat
atcaatagtggttatgagaccagacggaaaaaaggaaaaaaagacaaagatatttcaaaa
gaaaaagatacacaaaatcagaatattactttggattgtgaaggaacgaccaacaaaatg
aagagcccagaaactaaacaaagaaagctttctccactgagactatcagtatcaaataat
caggaaccagattttattgatgatatagaagaaaaaactcctattagtaatgaagtagaa
atggaatcagaggagcagattgcagaaaggaaaaggaagatgacaagagaagaaagaaaa
atggaagcaattttgcaagcttttgccagacttgaaaagagagagaaaagaagagaacaa
gctttggaaaggatcagcacagccaaaactgaagttaaaactgaatgtaaagatacacag
attgtcagtgatgctgaagttattcaggaacaagcaaaagaagaaaatgctagcaagcca
acccctgccaaagtaaatagaactaaacagagaaaaagtttttctcggagtaggactcac
attggacagcagcgtcggagacacagaactgtcagcatgtgttcagatatccagccatct
tctcctgatatagaagttacttcacaacaaaatgatattgaaaatactgtacttacaata
gaaccagaaactgaaactgcactagcagaaataattactgaaactgaagttccagcactt
aataaatgtcctacaaagtaccccaaaacaaagaagcacttggtcaatgaatggttaagt
gagaagaatgagaagacaggaaaaccttcagatggcctttcagaaaggcctctacgcata
actacagatcctgaagtgttagctacacaactcaattctttaccaggtctcacttacagc
ccccatgtatactctactcctaagcattatattagatttacttcaccattcctttcagaa
aaaaggagaagaaaagaacctgctgaaaacatttctggttcatgcaagaagcgatggttg
aaacaagctctggaagaagaaaattcagcaattttacatagatttaattcaccctgtcaa
gaaagatccagaagtcctgcagtcaatggtgaaaataaaagtccactactattaaatgac
agctgttcccttccagatttaactacaccactaaaaaaacgaagattttatcagttgcta
gattcggtttactcagaaacttccacacctactccttccccgtatgctacaccaactcac
accgatactactcctatggacccatcttttgccacgcctccacggataaaatcagatgat
gaaacttgtagaaatggttataaacccatatattcaccagttaccccagtaactcctggt
acaccaggaaataccatgcactttgagaatatttcttccccagaaagttctccagaaata
aagagacgcacttatagtcaagagggatatgacagatcttcaaccatgttaacattgggg
ccttttagaaattccaatttaactgaactgggtctgcaagaaataaagactattggttat
acgagccctaggagtaggactgaagtcaacaggcagtgccctggagaaaaggaacctgtg
tcagaccttcagctaggactcgatgcagttgagccaactgccctacataaaaccctggaa
acgcctgcacatgacagggctgagcccaacagccaactggactcaactcactctggacgg
ggcacaatgtattcttcctgggtaaagagccctgacagaacaggagttaacttctcagtg
aactccaacttgagggacctgacaccctcgcatcagttggaggttggaggaggcttccga
ataagtgagtcaaagtgcctgatgcaggatgatactagaggcatgtttatggaaacaact
gtgttttgtacttccgaagatgggcttgtatctggtttcggacggactgttaatgacaat
ttgatcgacgggagttgcacaccccagaatccaccacaaaagaaaaaggtttctctatta
gaataccgtaagagacaacgtgaagctaggaaaagtggctctaagacagagaactttcca
ctcattagtgtatcaccccatgcaagtggaagcttgagcaccaatggtgatggctgtgcc
agcagtaatgagaatggggagcaggtggaacacactgctagcctacctttaccaacacca
gctacagtttataatgccacttctgaagaaactagcaataactgccctgttaaggatgct
actgccagtgagaagaatgaaccagaagttcaatggactgcctcaacttcagtggaacaa
gtcagagaaaggagttatcagagagctttacttctcagtgatcaccgaaaagataaagac
agtgggggagaatcaccatgtgtctcatgttcaccgagtcatgttcagtcttcaccttca
tctcattcaaatcacataccccagttgcaagctaagggcccagtcccttctttcagtgaa
ctgatggaagaccctgatcctgaaaatccagaacccacaactacaaatgaatgtccatcc
ccagatacttctcaaaatacttgtaaaagtccttcaaaaatgagcaagcctggttcacct
ggatctgtaattcctgctcaagcacacgggaaaatattcacaaaaccagatccccaatgg
gactccacagttagtgcatccgaagctgaaaacggtgttcacctaaaaacagagctccaa
caaaaacagctatcaaataccaaccaagcactttcaaagaatcatcctcctcagacacat
gttcgtaattcatctgagcaactttcacaaaagctgccttctgcaccaacaaagttgcac
tgtcctccatcacctcacctagaaaatcctccaaagtcatccacgcctcacacacctgta
cagcatggttatctttcaccaaagcctccttcacagcagttaggatctccctacaggcct
catcattcacagtcacctcaagttggaacacctcagcgagagcctcaaagaaacttttat
ccagcagcacagaaccttcaagccaatactcagcaggcaacttctggaacattatttaca
cagacaccctcaggacaatcttcagcaacatacagtcagtttaaccaacaaagtctgaac
agcacggcaccaccccctccacctcctccacctccttcgtcttactatcaaaaccagcag
ccctctgcaaactttcagaattataatcagctcaaaggtagtctttctcaacaaactgtg
tttacatcaggaccaaatcaagcacttcctggcaccacaagccagcaaacagttccagga
caccacgtgactccagggcattttttgccctctcaaaaccctaccattcaccatcaaact
gctgctgccgtagtcccccctcctccaccaccaccacctgctccaggaccgcaccttgta
caacagccgaattcccatcagcaacactctgtagcacatgtagtagggcctgttcatgcg
gtcacccctgggtcgcatattcattctcaaactgctggacaccacttacccccaccccca
ccccctcccggtcctgcccctcatcaccatccaccaccccatccttccacaggactccaa
ggtctacaagcacaacaccagcatgttgtaaattcagcacccccaccaccccctccgccg
ccaccttccagtgttttggcttctgggcatcataccacatcagctcaagccttacaccac
ccacctcatcaaggacctccactttttccttcaagtgctcatccagctgtaccaccgtat
ccctcacaagctacacatcataccactttgggaccgggaccccagcaccagccttctgga
acagggccacattgtccattacctgtcacaggtcctcatctccagccccaaggaccaaac
agtattccaacacctactgcttcagggttctgtcctcatcctggctctgtggccctgcca
catggggttcaaggacctcagcaggcatctccagtgcctggacagattccaattcacaga
gcacaggtgccaccaacatttcaaaacaattaccatgggtncaggtggcattaa

DBGET integrated database retrieval system