KEGG   Pongo abelii (Sumatran orangutan): 100173976Help
Entry
100173976         CDS       T01416                                 

Gene name
EIF4E2
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:pon03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:pon04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pon04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:pon04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:pon04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2B
AA seq 236 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEYPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgctttgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagaatcaaagc
agtagcaagagaaaggctgttgtccctggaccggcagagtatcccctgcagtacaactac
actttttggtactccaggagaacccccggccgtcccacgagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttatagccac
atggtacgtcccggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcggctgcgg
aagggcttggcctcccgttgctgggagaatctcattttggccatgctgggggaacagttc
atggttggggaggagatctgtggggctgtggtgtctgtccgctttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgaatccgggacacactt
cgacgagtgcttaacctacctcccaacaccattatggaatacaaaactcacaccgacagc
atcaaggcctgggaggagtttcatggcctggtgaacagcagcggccgctga

DBGET integrated database retrieval system