KEGG   Pongo abelii (Sumatran orangutan): 100174079Help
Entry
100174079         CDS       T01416                                 

Gene name
USP5, UBP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T) (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 858 aa AA seqDB search
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGPRVYLHLRRTRRPKEEDPTTGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWECSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVLVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgagtgaggaggcgctgctgtcagtattaccgacgatccgggtccctaag
gctggagaccgggtccacaaagacgagtgcgccttctccttcgacacgccggagtctgag
ggcggtctctacatctgtatgaacacatttctgggctttgggaaacagtatgtggagaga
catttcaataagacgggcccgcgagtctacttgcacctccggcggacccggcgcccgaaa
gaggaggaccctactacaggcactggagacccaccccggaagaagcccacgcggctggct
attggtgttgaaggcgggtttgaccttagcgaggagaagtttgaattagacgaggatgtg
aagattgtcattttgccagattacctggagattgcccgggatggactggggggactgcct
gacattgtcagagatcgggtgaccagtgcagtggaggccctactgtcggccgactcagct
tcccgcaagcaggaggtgcaggcatgggatggggaagtacggcaggtgtctaagcatgcc
ttcagcctcaagcagttggacaaccctgctcgaatccctccctgtggctgggagtgctcc
aagtgtgacatgagagagaacctgtggctcaacctgactgatggctccatcctctgtggg
cgacgctacttcgacggcagtgggggcaacaaccacgctgtggagcactaccgggagaca
ggctacccgttagctgtcaagctgggcaccatcacccctgatggagctgacgtgtactca
tatgatgaggatgacatggtcctggaccccagcctagctgagcatctgtcccacttcggc
atcgacatgctgaagatgcagaagacagacaagacgatgactgagttggagatagacatg
aaccagcggattggtgaatgggagctgatccaggagtcgggtgtgccactcaagcccctg
tttgggcctggctacacaggcatccggaacctgggtaacagctgctacctcaactccgtg
gtcctggtgctcttcagcatccctgacttccagaggaagtatgtggataagctggagaag
atcttccagaatgctccgacggaccctacccaggacttcagcacccaggtggccaagctg
ggccatggccttctctccggggagtattccaagccagtaccggagtcgggcgatggggag
cgggtgccagaacagaaggaagttcaagatggcattgcccctcggatgttcaaggccctc
atcggcaagggccaccctgaattctccaccaaccggcagcaagatgcccaggagttcttc
cttcaccttatcaacatggtggagaggaattgccggagctctgaaaatcctaatgaagtg
ttccgcttcttggtggaggaaaagatcaagtgcctggccacagagaaggtgaagtacacc
cagcgagttgactacatcatgcagctgcctgtgcccatggatgcagcccttaacaaagaa
gagcttctggagtacgaggagaagaaacggcaagccgaagaggagaagatggcactgcca
gaactggttcgggcccaggtgcccttcagctcttgcctggaggcctacggggcccctgag
caggtcgatgacttctggagcacggccctgcaggccaagtcagtagctgtcaagaccaca
agatttgcctcattccctgactacctggtcatccagatcaagaagttcacctttggctta
gactgggtgcccaagaaactggatgtgtccatcgagatgccagaggagctcgacatctcc
cagctgaggggcacagggctgcagcctggagaggaggagctgccagacattgccccaccc
ctggtcactccggatgagcccaaaggtagccttggtttctatggcaacgaagacgaagac
tccttctgctcccctcacttctcctctccgacatcgcccatgctggatgaatcagtcatc
atccagctggtggagatgggcttccctatggacgcctgccgcaaagctgtctactacacg
ggcaacagtggggccgaggccgccatgaactgggtcatgtcacacatggatgatccagat
tttgcaaaccccctcatcctgcctggctctagtgggccaggctccacaagcgcggcagcc
gacccccctcccgaggactgcgtgaccaccattgtctccatgggcttctcccgggaccag
gccctgaaagcgctgcgggccacgaacaatagtttagaacgggctgtggactggatcttc
agtcacattgacgacctggatgctgaagctgccatggacatctcagagggccgctcagct
gccgactccatctctgagtctgtgccagtgggacctaaagtccgggatggtcctggaaag
tatcagctctttgccttcattagtcacatgggcacctctaccatgtgtggtcactatgtc
tgccacatcaagaaggaaggcagatgggtgatctacaatgaccagaaagtgtgtgcctcc
gagaagccgcccaaggacctgggctacatctacttctaccagagagtggccagctaa

DBGET integrated database retrieval system