KEGG   Pongo abelii (Sumatran orangutan): 100174088Help
Entry
100174088         CDS       T01416                                 

Gene name
ST6GAL1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:pon00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:pon00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 406 aa AA seqDB search
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAIGSDS
QSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFPVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYEGPGPGIKFSAEALRCHLWDYVNVSMVEATDFPFNTSEWEGYLPKESIRTKAGP
WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE
KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKSYRKLHPNQPFYILKPQM
PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF
DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaccaacttgaagaaaaagttcagctgctgcgtcctggtctttcttctgttt
gcagtcatctgtgtgtggaaggaaaagaagaaagggagttactatgattcctttaaattg
caaaccaaggaattccaggtgttgaagagtctggggaaattggccatagggtctgattcc
cagtctgtatcctcaagcagcacccaggacccccacaggggccgccagaccctcggcagt
ctcagaggcctagccaaggccaaaccagaggcctccttcccggtgtggaacaaggacagc
tcttccaaaaaccttatccctaggctgcaaaaaatctggaagaattacctaagcatgaac
aagtacaaagtgtcctacgaggggccaggaccaggcatcaagttcagtgcagaggccctg
cgctgccacctctgggactatgtgaatgtatccatggtagaagccacagattttcccttc
aatacctctgaatgggagggttatctgcccaaggagagcattaggaccaaggctgggcct
tggggcaggtgtgctgttgtgtcgtcagcgggatctctgaagtcctcccaactaggcaga
gaaatcgatgatcatgacgcagtcctgaggtttaatggggcacccacagccaacttccaa
caagatgtgggcacaaaaactaccattcgcctgatgaactctcagttggttaccacagag
aagcgcttccttaaagacagtttgtacaatgaaggaatcctaattgtatgggacccatct
gtataccattcagatatcccaaagtggtaccagaatccagattataatttctttaataac
tacaagagttatcgtaagctgcaccccaatcagcccttttacatcctcaagccccagatg
ccttgggagctatgggacattcttcaagaaatctccccagaagagattcagccaaacccc
ccatcctctgggatgcttggtatcatcatcatgatgacgctgtgtgaccaggtggacatt
tatgagttcctcccatccaagcgcaagactgacgtgtgctactactaccagaagttcttt
gatagtgcctgcacgatgggtgcctaccacccgctgctctatgagaagaatttggtgaag
catctcaaccagggcacagatgaggacatctacctgcttggaaaagccacactgcctggc
ttccggaccattcactgctaa

DBGET integrated database retrieval system