KEGG   Pongo abelii (Sumatran orangutan): 100174182Help
Entry
100174182         CDS       T01416                                 

Gene name
ALAD
Definition
aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100174182 (ALAD)
Enzymes [BR:pon01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100174182 (ALAD)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100174182 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 339 aa AA seqDB search
MPLCPLAHTMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPIASLP
GVARYGVNRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT
FPNLLVACDVCLCPYTSHGHCGLLSENGAFQAEESRQRLAEVALAYAKAGCQVVAPSDMM
DGRVEAIKETLMAHGLGSRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGAR
GLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQA
GAFDLKAAVLEAMTAFRRAGADIIITHYTPQLLQWLKEE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtgcccactggcccacaccatgcagccccagtccgttctgcacagcggctac
ttccacccactgcttcgggcctggcagacagccaccaccaccctcaatgcctccaacctc
atctaccccatctttgtcacggatgttcctgatgacatacagcctatcgccagcctccca
ggagtggccaggtatggtgtgaaccggctggaagagatgctgaggccgttggtggaagag
ggcctacgctgtgtcttgatctttggcgtccccagcagagttcccaaggatgagcggggt
tccgcagctgactccgaggagtccccagctattgaggcaatccatctgttgaggaagacc
ttccccaacctcctggtggcctgtgacgtctgcctgtgtccctacacctcccatggtcac
tgcgggctcctgagtgaaaatggagcgttccaggctgaggagagccgccagcggctggct
gaggtggcattggcgtatgccaaggcaggatgtcaggtggtagccccgtcggacatgatg
gatggacgcgtggaagccatcaaagagaccctgatggcacatggacttggcagcagggta
tcagtgatgagctacagtgccaagtttgcttcctgtttctatggccctttccgggatgcg
gctaagtcaagcccagcttttggggaccgccgctgctaccagctgccccctggagcacga
ggcctggctctccgagctgtggaccgggatgtacgggaaggagctgacatgctcatggtg
aagccgggaatgccctacctggacatcgtgcgggaggtaaaggacaagcaccccgacctc
cctctcgccgtgtaccacgtctctggagagtttgccatgctgtggcacggagcccaggcc
ggggcatttgatctcaaggctgccgtactggaggccatgactgccttccgcagagcaggt
gctgacatcatcatcacccactacacaccgcagctgctgcagtggctgaaggaggaatga

DBGET integrated database retrieval system