KEGG   Pongo abelii (Sumatran orangutan): 100174182Help
Entry
100174182         CDS       T01416                                 

Gene name
ALAD
Definition
aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pon00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 339 aa AA seqDB search
MPLCPLAHTMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPIASLP
GVARYGVNRLEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT
FPNLLVACDVCLCPYTSHGHCGLLSENGAFQAEESRQRLAEVALAYAKAGCQVVAPSDMM
DGRVEAIKETLMAHGLGSRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGAR
GLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQA
GAFDLKAAVLEAMTAFRRAGADIIITHYTPQLLQWLKEE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtgcccactggcccacaccatgcagccccagtccgttctgcacagcggctac
ttccacccactgcttcgggcctggcagacagccaccaccaccctcaatgcctccaacctc
atctaccccatctttgtcacggatgttcctgatgacatacagcctatcgccagcctccca
ggagtggccaggtatggtgtgaaccggctggaagagatgctgaggccgttggtggaagag
ggcctacgctgtgtcttgatctttggcgtccccagcagagttcccaaggatgagcggggt
tccgcagctgactccgaggagtccccagctattgaggcaatccatctgttgaggaagacc
ttccccaacctcctggtggcctgtgacgtctgcctgtgtccctacacctcccatggtcac
tgcgggctcctgagtgaaaatggagcgttccaggctgaggagagccgccagcggctggct
gaggtggcattggcgtatgccaaggcaggatgtcaggtggtagccccgtcggacatgatg
gatggacgcgtggaagccatcaaagagaccctgatggcacatggacttggcagcagggta
tcagtgatgagctacagtgccaagtttgcttcctgtttctatggccctttccgggatgcg
gctaagtcaagcccagcttttggggaccgccgctgctaccagctgccccctggagcacga
ggcctggctctccgagctgtggaccgggatgtacgggaaggagctgacatgctcatggtg
aagccgggaatgccctacctggacatcgtgcgggaggtaaaggacaagcaccccgacctc
cctctcgccgtgtaccacgtctctggagagtttgccatgctgtggcacggagcccaggcc
ggggcatttgatctcaaggctgccgtactggaggccatgactgccttccgcagagcaggt
gctgacatcatcatcacccactacacaccgcagctgctgcagtggctgaaggaggaatga

DBGET integrated database retrieval system