KEGG   Pongo abelii (Sumatran orangutan): 100174202Help
Entry
100174202         CDS       T01416                                 

Gene name
UGT2A3
Definition
(RefSeq) UDP-glucuronosyltransferase 2A3 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00040  Pentose and glucuronate interconversions
pon00053  Ascorbate and aldarate metabolism
pon00140  Steroid hormone biosynthesis
pon00830  Retinol metabolism
pon00860  Porphyrin and chlorophyll metabolism
pon00980  Metabolism of xenobiotics by cytochrome P450
pon00982  Drug metabolism - cytochrome P450
pon00983  Drug metabolism - other enzymes
pon01100  Metabolic pathways
pon05204  Chemical carcinogenesis
Module
pon_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100174202 (UGT2A3)
   00053 Ascorbate and aldarate metabolism
    100174202 (UGT2A3)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100174202 (UGT2A3)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100174202 (UGT2A3)
   00860 Porphyrin and chlorophyll metabolism
    100174202 (UGT2A3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100174202 (UGT2A3)
   00982 Drug metabolism - cytochrome P450
    100174202 (UGT2A3)
   00983 Drug metabolism - other enzymes
    100174202 (UGT2A3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100174202 (UGT2A3)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100174202 (UGT2A3)
Glycosyltransferases [BR:pon01003]
 Others
  Hydrophobic molecule
   100174202 (UGT2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 100174202
NCBI-ProteinID: NP_001127151
Ensembl: ENSPPYG00000014785
UniProt: Q5RFJ3
Position
4
AA seq 527 aa AA seqDB search
MRSEKSALVFLLLQLFCVGCGFCGKVLVWPCDMSHWLNVKVILEELIVRGHEVTVLTHSK
SLLIDYRKPSALKFEVVHMPQDKTEGNEVFVDLALNVLPGLPTWQSVIKLNDFFVEIRGT
LKMMCESFIYNQTLMKKLQETNYDVMLIDPVIPCGDLMAELLAVPFVLTLRISLGGNMER
SCGKLPAPLSYVPVPMTGLTDRMTFLERVKNSMLSVFFHFWIQDYDYHFWEEFYSKALGR
PTTLCETVGKAEIWLIRTYWDFEFPQPYQPNFEFVGGLHCKPAKALPKEMENFVQSSGED
GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGTNTRLYDWIPQNDL
LGHPKTKAFITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTS
EDLLRALRTVTTNSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHN
LTWFQHYSIDVIGFLLACVATAIFLFTKCCLFSCQKFNKTRKIEKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctgagaagtcagctttggtatttctgctcctgcagctcttctgtgttggctgt
ggattctgtgggaaagtcctggtatggccctgtgacatgagccattggcttaatgtcaag
gtcattctagaagagctcatagtgaggggccatgaggtaacagtattgactcactcaaag
tctttgttaattgactacaggaagccttctgcattgaaatttgaggtggtccatatgcca
caggacaaaacagaaggaaatgaagtatttgttgacctagctctgaatgtcttgccaggc
ttaccaacctggcaatcagttataaaactaaatgatttttttgttgaaataagaggaact
ttaaaaatgatgtgtgagagctttatctacaatcagacacttatgaagaagctacaggaa
accaactacgatgtaatgcttatagaccctgtgattccctgtggagacctgatggctgag
ttgcttgcagtcccttttgtgctcacacttagaatttctctaggaggcaatatggagcga
agctgtgggaaacttccagctccactttcctatgtacctgtgcctatgacaggactaaca
gacagaatgacctttctggaaagagtaaaaaattcaatgctttcagttttcttccacttc
tggattcaggattatgactatcatttttgggaagagttttatagtaaggcattaggaagg
cccactacattatgtgagactgtgggaaaagctgagatatggctaatacgaacatattgg
gattttgaatttcctcaaccatatcaacctaattttgagtttgttggaggattgcactgt
aaacctgccaaagctttgcctaaggaaatggaaaattttgtccagagttcaggggaagat
ggtattgtggtgttttctctggggtcactgtttcaaaatgttacagaagaaaaggctaat
atcattgcttcagcccttgcccagatcccacagaaggtgttatggaggtacaaaggaaaa
aaaccatccacattaggaaccaatactcggctgtatgattggataccccagaatgatctt
cttggtcatcccaaaaccaaagcttttatcactcatggtggaatgaacgggatctatgaa
gctatttaccatggggtccctatggtgggagttcccatatttggtgatcaacttgataac
atagctcacatgaaggccaaaggagcagctgtagaaataaacttcaaaactatgacaagc
gaagatttactgagggctttgagaacagtcactaccaattcctcttataaagagaatgct
atgagattatcaagaattcaccatgatcaacctgtaaagcccctagatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcacctgcgatcagctgcccacaac
ctcacctggttccagcactactctatagatgtgattgggttcctgctggcctgcgtggca
actgctatattcttgttcacaaaatgttgtttattttcctgtcaaaaatttaataaaact
agaaagatagaaaagagggaatag

DBGET integrated database retrieval system