KEGG   Pongo abelii (Sumatran orangutan): 100174305Help
Entry
100174305         CDS       T01416                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100174305 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100174305 (PDIA3)
Enzymes [BR:pon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100174305 (PDIA3)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100174305 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   100174305 (PDIA3)
  Exosomal proteins of bladder cancer cells
   100174305 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 505 aa AA seqDB search
MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPVIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctccgccgcctagcgctgttcccgggtgtggcgctgcttcttgccgcggcccgc
ctcgccgctgcctccgacgtgctagaactcacggacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aagagacttgcacctgagtatgaagctgcagctaccagattaaaaggaatagtcccatta
gcaaaggttgattgcactgccaacactaacacctgtaataaatatggagtcagtggatat
ccaaccctgaagatatttagagatggtgaagaagcaggtgcttatgatggacctaggact
gctgatggaattgtcagccacttgaagaagcaggcaggaccagcttcagtgcctctcagg
actgaggaagaatttaagaaattcattagtgataaagatgcctctatagtaggttttttc
gatgattcattcagtgaggctcactccgagttcctaaaagcagccagcaacttgagggat
aactaccgatttgcacatacgaatgttgagtctctggtgaacgagtatgatgataatgga
gagggtatcatcttatttcgtccttcacatctcactaacaagtttgaggacaagactgtg
gcatatacagagcaaaaaatgaccagtggcaaaattaaaaagtttatccaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttattgcttactatgatgtggactatgaaaagaacgctaaaggttccaactactggaga
aacagggtaatgatggtggcaaagaaattcctggatgctgggcacaaactcaactttgct
gtagctagccgcaaaacctttagccatgaactttctgattttggcttggagagcactgct
ggagagattcctgttgttgctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgtgacgggaaggctctggagaggttcctgcaggattactttgatggcaat
ctgaagagatacctgaagtctgaacctatcccagagagcaatgatgggcctgtgaaggta
gtggtagcagagaattttgatgaaatagtgaataatgaaaataaagatgtgctgattgaa
ttttatgccccttggtgtggtcactgtaagaacctggagcccaagtataaagaacttggc
gagaagctcagcaaagacccaaatatcgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatatacttctctccagccaacaag
aagctaaatccaaagaaatatgaaggcggccgtgaattaagtgattttattagctatcta
caaagagaagctacaaacccccctgtaattcaagaagaaaaacccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system