KEGG   Pongo abelii (Sumatran orangutan): 100174410Help
Entry
100174410         CDS       T01416                                 

Gene name
KAT5
Definition
(RefSeq) histone acetyltransferase KAT5
  KO
K11304  histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05166  HTLV-I infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100174410 (KAT5)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100174410 (KAT5)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100174410 (KAT5)
   HAT complexes
    TIP60 complex
     100174410 (KAT5)
    NuA4 complex
     100174410 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_7 Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 100174410
NCBI-ProteinID: NP_001127347
Ensembl: ENSPPYG00000003052
UniProt: Q5RBG4 A0A2J8TZK4
Position
11
AA seq 461 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVKRKVEVVSPATPVPSETAPASVFPQ
NGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNI
ECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNE
IYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIV
GYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLL
SYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQY
ILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctacccgtgctgcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgg
aagcttttctacgtccattacattgacttcaacaaacgtctggatgaatgggtgacgcat
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccactaag
aacggacttcctgggtcccgtcctggctctccagagagagaggtgaaacggaaggtggag
gtggtttcaccagcaactccagtgcccagcgagacagccccggcctcggtttttccccag
aatggagccgcccgtagggcagtggcagcccagccaggacggaagcgaaaatcgaattgt
ttgggcactgatgaggactcccaggacagctctgatggaataccgtcagcaccacgcatg
actggcagcctggtgtctgatcgaagccacgacgacatcgtcacccggatgaagaacatt
gagtgcattgagctgggccggcaccgcctcaagccgtggtacttctccccgtacccacag
gaactcaccacattgcctgtcctctacctgtgcgagttctgcctcaagtacggccgtagt
ctcaagtgtcttcagcgtcatttgaccaagtgtgacctacgacatcctccaggcaatgag
atttaccgcaagggcaccatctccttctttgagattgatggacgtaagaacaagagttat
tcccagaacctgtgtcttttggccaagtgtttccttgaccataagacactgtactatgac
acagaccctttcctcttctacgtcatgacagagtatgactgtaagggcttccacatcgtg
ggctacttctccaaggagaaagaatcaacggaagactacaatgtggcctgcatcctaacc
ctgcctccctaccagcgccggggctacggcaagctgctgatcgagttcagctatgaactc
tccaaagtggaagggaaaacagggacccctgagaagcccctctcagaccttggcctccta
tcctatcgaagctactggtcccagaccatcctggagatcctgatggggctgaagtcggag
agcggggagaggccacagatcaccatcaatgagattagtgaaatcaccagcatcaagaag
gaggatgtcatctccactctgcagtacctcaatctcatcaactactacaagggccagtac
atcctcacactgtcagaggacatcgtggatggccatgagcgggccatgctcaagcggctc
ctgcggatcgactccaagtgtctgcacttcactcccaaggactggagcaagagggggaag
tggtga

DBGET integrated database retrieval system