KEGG   Pongo abelii (Sumatran orangutan): 100174410Help
Entry
100174410         CDS       T01416                                 

Gene name
KAT5, HTATIP, TIP60
Definition
K(lysine) acetyltransferase 5 (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100174410 (KAT5)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100174410 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 461 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVKRKVEVVSPATPVPSETAPASVFPQ
NGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNI
ECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNE
IYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIV
GYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLL
SYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQY
ILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctacccgtgctgcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgg
aagcttttctacgtccattacattgacttcaacaaacgtctggatgaatgggtgacgcat
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccactaag
aacggacttcctgggtcccgtcctggctctccagagagagaggtgaaacggaaggtggag
gtggtttcaccagcaactccagtgcccagcgagacagccccggcctcggtttttccccag
aatggagccgcccgtagggcagtggcagcccagccaggacggaagcgaaaatcgaattgt
ttgggcactgatgaggactcccaggacagctctgatggaataccgtcagcaccacgcatg
actggcagcctggtgtctgatcgaagccacgacgacatcgtcacccggatgaagaacatt
gagtgcattgagctgggccggcaccgcctcaagccgtggtacttctccccgtacccacag
gaactcaccacattgcctgtcctctacctgtgcgagttctgcctcaagtacggccgtagt
ctcaagtgtcttcagcgtcatttgaccaagtgtgacctacgacatcctccaggcaatgag
atttaccgcaagggcaccatctccttctttgagattgatggacgtaagaacaagagttat
tcccagaacctgtgtcttttggccaagtgtttccttgaccataagacactgtactatgac
acagaccctttcctcttctacgtcatgacagagtatgactgtaagggcttccacatcgtg
ggctacttctccaaggagaaagaatcaacggaagactacaatgtggcctgcatcctaacc
ctgcctccctaccagcgccggggctacggcaagctgctgatcgagttcagctatgaactc
tccaaagtggaagggaaaacagggacccctgagaagcccctctcagaccttggcctccta
tcctatcgaagctactggtcccagaccatcctggagatcctgatggggctgaagtcggag
agcggggagaggccacagatcaccatcaatgagattagtgaaatcaccagcatcaagaag
gaggatgtcatctccactctgcagtacctcaatctcatcaactactacaagggccagtac
atcctcacactgtcagaggacatcgtggatggccatgagcgggccatgctcaagcggctc
ctgcggatcgactccaagtgtctgcacttcactcccaaggactggagcaagagggggaag
tggtga

DBGET integrated database retrieval system