KEGG   Pongo abelii (Sumatran orangutan): 100174446Help
Entry
100174446         CDS       T01416                                 

Gene name
HIBCH
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100174446 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100174446 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100174446 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100174446 (HIBCH)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100174446 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 338 aa AA seqDB search
MGQREVWRIMSRFNAFKRTNTILHHLRMSKHTDAAEDVLLEKKGCAGVITLNRPKFLNAL
TLNMIQKIYPQLKKWEQDPETFLIVIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEIIENLQQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACVF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcgggaggtgtggaggatcatgtcgaggtttaatgcattcaaaaggactaat
accatactgcaccatttgagaatgtccaagcacacagatgcagcagaagatgtgctattg
gaaaaaaaaggttgtgcgggagtcataacactaaacagaccaaagttcctcaatgcactg
actcttaatatgattcagaagatttatccacagctgaagaagtgggaacaagatcctgaa
actttcctgatcgttataaagggagctggaggaaaggctttctgtgctgggggtgatatc
agagtgatctcggaagctgaaaaggcaaaacagaagatagctccagttttcttcagagaa
gaatatatgctgaacaatgctgttggttcttgccagaaaccttatgttgcacttattcat
ggaattacaatgggtgggggagttggtctctcagtccatgggcaatttcgagtggctaca
gaaaaatgtctttttgctatgccagaaactgcaataggactgttccctgatgtgggtgga
ggttatttcttgccacgactccaaggaaaacttggttacttccttgcattaacaggattc
agactaaaaggaagagatgtgtacagagcaggaattgctacacactttgtagattctgaa
aagttggccatgttagaggaagatttgttagccttgaaatctccttcaaaagaaaatatt
gcatctgtcttagaaaattaccatacagagtctaagattgatcgggacaagtcttttata
cttgaggaacacatggacaaaataaacagttgtttttcagccaatactgtggaagaaatt
attgaaaacttacagcaagatggttcatcttttgccctagagcaattgaaggtaattaat
aaaatgtctccaacatctctaaagatcactctaaggcaactcatggaggggtcttcaaag
accttgcaagaagtactaactatggagtatcggctaagtcaagcttgtgtgttttaa

DBGET integrated database retrieval system