KEGG   Pongo abelii (Sumatran orangutan): 100174547Help
Entry
100174547         CDS       T01416                                 

Gene name
GK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pon00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:pon03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 530 aa AA seqDB search
MAASNKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIY
GLMKISHSLKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCV
FSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSL
EPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcaaataaggcagttttggggccattggtgggggcggtggaccagggcacc
agttcgacgcgctttttggttttcaattcaaaaacagctgaactacttagtcatcatcaa
gtagaaataaaacaagagttcccaagagaaggatgggtggaacaggaccctaaggaaatt
ctacattctgtctatgaatgtatagagaaaacatgtgagaaacttggacagctcaatatt
gatatttccaacataaaagctatcggtgtcagcaaccagagggaaaccactgtagtctgg
gacaagataactggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
tctaccgttgagagtcttagtaaaagaattccaggaaataataactttgtcaagtccaag
acaggccttccacttagcacttacttcagtgcagtgaaacttcgttggctccttgacaat
gtgagaaaggttcaaaaggccgttgaagaaaaacgagctctttttgggactattgattca
tggcttatttggagtttgacaggaggagtcaatggaggtgtccactgtacagatgtaaca
aatgcaagtaggactatgcttttcaacattcattctttggaatgggataaacaactctgc
gaattttttggaattccaatggaaattcttccaaatgtccggagttcttctgagatctat
ggcctaatgaaaatctctcatagcctgaaagctggggccttggaaggtgtgccaatatct
gggtgtttaggggaccagtctgctgcattggtgggacaaatgtgcttccagattggacaa
gccaaaaatacgtatggaacaggatgtttcttactatgtaatacaggccataagtgtgta
ttttctgatcatggccttctcaccacagtggcttacaaacttggcagagacaaaccagta
tattatgctttggaaggttctgtagctatagctggtgctgttattcgctggctaagagac
aatcttggaatcataaagacctcagaagaaattgaaaaacttgctaaagaagtaggtact
tcttatggctgctacttcgtcccagcattttcggggttatatgcaccttattgggagccc
agcgcaagagggataatctgtggactcactcagttcaccaataaatgccatattgctttt
gctgcattagaagctgtttgtttccaaactcgagagattttggatgccatgaatcgagac
tgtggaattccactcagtcatttgcaggtagatggaggaatgaccagcaacaaaattctt
atgcagctacaagcagacattctgtatataccagtagtgaagccctcaatgcccgaaacc
actgcactgggtgctgccatggcagcaggggctgcagaaggagtcggcgtatggagtctg
gaacccgaggatttgtctgccgtcacgatggagcggtttgaacctcagattaatgctgag
gaaagtgaaattcgttattctacatggaagaaagctgtgatgaagtcaatgggttgggtt
acaactcaatctccagaaagtggtattccataa

DBGET integrated database retrieval system