KEGG   Pongo abelii (Sumatran orangutan): 100174614Help
Entry
100174614         CDS       T01416                                 

Gene name
CHP1, CHP
Definition
calcineurin-like EF hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100174614 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
accggcttttcccacagtcaaatcactcgcctctacagccggttcaccagcctggacaaa
ggagagaatgggactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttctttccagagggagaggaccaggtaaacttc
cgtggattcatgcgaactttggctcatttccgccccattgaggataatgaaaagagcaaa
gatgtgaatggacctgaaccactcaacagccgaagcaacaaactgcactttgcttttcga
ctatatgatttggataaagatgaaaagatctcccgtgatgagctgttacaggtgctacgc
atgatggtcggagtaaatatctcagatgagcagctgggcagcatcgcagacaggaccatt
caggaggctgatcaggatggggacagtgccatatctttcacagaatttgttaaggttttg
gagaaggtggatgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system