KEGG   Pongo abelii (Sumatran orangutan): 100174635Help
Entry
100174635         CDS       T01416                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100174635 (UCHL5)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100174635 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 355 aa AA seqDB search
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKDGFSPCCPGWSQTPELKPSACLDLPKWYSE
GEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEE
VQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgccggggagtggtgcctcatggaaagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggagcccaagtagaagaaatatggagtttagagcct
gagaattttgaaaaattaaagccagttcatgggttaatttttcttttcaagtggcagcca
ggagaagaaccagcaggctctgtggttcaggactcccgacttgacacgatattttttgct
aagcaggtaattaataatgcttgtgctactcaagccatagtgagtgtgttactgaactgt
acccaccaggatgtccacttaggcgagacattatcagagtttaaagaattttcacaaagt
tttgatgcagctatgaaaggcttggcactgagcaattcagatgtgattcgacaagttcac
aacagtttcgccagacagcaaatgtttgaatttgatacgaagacatcagcaaaagaagaa
gatgcttttcactttgtcagttatgttcctgttaatgggagactgtatgaattagatggg
ttaagagaaggaccgattgatttaggtgcatgcaatcaagatgattggatcagtgcagta
aggcctgtcatagaaaaaaggatacaaaaagacgggttttcaccatgttgcccaggctgg
tctcagactcctgagctcaagccatccgcctgcctcgacctcccaaagtggtacagtgaa
ggtgaaattcgatttaatttaatggccattgtgtctgacagaaaaatgatatatgaacag
aagatagcagagttacaaagacaacttgcagaggaacccatggatacagatcaaggtaat
agtatgttaagtgctattcagtcagaagttgccaaaaatcagatgcttattgaagaagaa
gtacagaaattaaaaagatacaagattgagaatatcagaaggaagcataattatctgcct
ttcattatggaattgttaaagactttagcagaacaccagcagttaataccactagtagaa
aaggcaaaagaaaaacagaacgcaaagaaagcccaggaaaccaaatga

DBGET integrated database retrieval system