KEGG   Pongo abelii (Sumatran orangutan): 100174685Help
Entry
100174685         CDS       T01416                                 

Gene name
EHHADH, ECHD, PBE, PBFE
Definition
enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase (EC:1.1.1.35 5.3.3.8 4.2.1.17)
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:pon01200]
Metabolism; Overview; Fatty acid metabolism [PATH:pon01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pon00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pon00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pon00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pon00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pon00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pon00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pon00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:pon04146]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:pon03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 723 aa AA seqDB search
MAEYTRLHNALALIRLRNPPVNAISTALLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAG
ADIHGFSAPRTFGFTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHSEAQV
GLPEVTLGLLPGARGTQLLPRLIGVPAALDLITSGRHILADEALKLGILDKVVNSDPVEE
AIRFAQRVSDQPLESRRLCNKPIQSLPNMDTIFSEALLKMRRQHPGCLAQEACVRAVQAA
VQYPYEVGVKKEEELFLYLFQSGQARALQYAFLAERKANKWSTPSGASWKTASARPVSSV
GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSG
PKPRLTSSMKELGGVDLVIEAVFEEMSLKKQVFAELSAICKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLNPYYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLT
GPTLPPGTPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKADPWLSKFL
SQYRETHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHK
GGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPQKEWQSLAGSPS
SKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtatacgcggctgcacaacgccttggcgctgatccgcctccgaaacccgccg
gtcaacgcgatcagtacggctttactccgtgacataaaagaaggactacagaaagctgta
atagaccatacaataaaagccattgtgatttgtggagcagagggcaaattttctgcaggt
gctgatattcatggcttcagcgctcctaggacatttggctttacactgggacatgtagta
gatgaaatacagagaaatgagaagcccgtggtggcagcaatccaaggcatggctttcgga
gggggactagagctggccctgggctgtcactataggattgcccactcagaggctcaagtt
ggcttaccagaagttacactgggacttctccctggtgcaagaggaacccagcttctcccc
agactcattggagttcctgctgcacttgacttaattacctcaggaagacatattttagca
gatgaagcactcaagctgggcattctagataaagttgtgaactcagacccggttgaagaa
gcaatcagatttgctcagagagtttcagatcaacctctagaatcccgtagactctgcaac
aagccaattcagagcttgcccaacatggacaccatttttagtgaggccctcttgaagatg
cggaggcagcaccccggatgtcttgcacaggaggcttgtgtccgtgcagtccaggctgcc
gtgcagtatccctatgaagtgggcgtcaagaaggaggaggagctgtttctatatcttttt
caatcagggcaggctagagccctgcaatatgctttcttagctgaaaggaaagcaaataag
tggtcaactccctccggagcatcgtggaaaacagcatcagcgcggcctgtctcctcagtt
ggtgttgttggcttaggaacaatgggccgaggcattgtcatttcttttgcaagggccagg
attcctgtgattgctgtagactcggacaaaaaccagctagcaactgcaaacaagatgata
acctctgtcttggaaaaagaagcctccaaaatgcaacagagcggccacccttggtcagga
ccaaaacccaggttaacttcatctatgaaggagcttggtggtgtagatttagtcattgaa
gcagtatttgaggaaatgagcctgaagaagcaggtctttgctgaactctcagctatctgc
aaaccagaagcatttttgtgcactaatacttcagccctggatgttgatgagattgcttct
tccactgatcgtcctcacttggtcattggcacccacttcttttcgccagctcatgtcatg
aagttgttagaggttattcccagccaatactcttcccccactaccattgccactgttatg
aacttatcaaaaaagattaaaaagattggagtcgttgtaggcaactgttttggatttgtg
gggaatcgaatgttgaatccttattacaatcaggcatatttcttgttagaagaaggcagc
aaaccagaggaggtagatcaggtgctagaagagtttggttttaaaatgggaccttttaga
gtttctgatcttgctgggttggatgtgggctggaaatctagaaaggggcaaggtcttact
ggacctacattgcctccaggaactcctgcccgaaaaaggggtaataggagatactgccca
attcctgatgtgctctgtgaattaggacgatttggccagaagacaggtaagggttggtat
caatatgacaagccattgggtaggattcacaaagccgatccctggctttccaaattccta
tcacagtatagagaaacccatcacattgaaccacgtaccattagccaggatgagatcctc
gagcgctgcttatattcacttatcaatgaagcattccgtatcttgggagaagggatagct
gctagcccagagcacattgatgttgtctatttacatggatatggatggccaaggcacaag
ggtgggcccatgttctatgcttccacagttgggttgcccacagttctagagaagttgcag
aaatattacaggcagaaccctgatattccccaactggagcccagtgactatctaaaaaaa
ctggcttctcagggaaaccctccccagaaagaatggcaaagcttggcaggctcccctagc
agtaaattgtga

DBGET integrated database retrieval system