KEGG   Pongo abelii (Sumatran orangutan): 100174711Help
Entry
100174711         CDS       T01416                                 

Gene name
CES1
Definition
(RefSeq) liver carboxylesterase 1 precursor
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00983  Drug metabolism - other enzymes
pon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100174711 (CES1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100174711 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Say1_Mug180 Esterase Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 100174711
NCBI-ProteinID: NP_001127632
Ensembl: ENSPPYG00000007361
UniProt: Q5R545
Position
16
AA seq 566 aa AA seqDB search
MWLRAFVLATLAASTAWGHLSSPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGIPFAKPPL
GSLRFTPPQPAELWSFVKNATSYPPMCSQDAVVGQFLSEVFTNRKENIPLKMSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSPGNWGHLDQLAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLQQKTEEELLETTLK
MKFLSLDLQGDPRESQPFLGTVIDGVLLLKTPEELQAERKFHTVPYMVGINKQEFGWIIP
MLLSSPFSEGKLDQKTAMSLLWKSYPLVQIAKELIPEATEKYLGGTDDPVKKKDLFLDLL
ADVMFGVPSVILARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFL
KEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPAYNQKEEYLQIGANTQAAQKLKD
KEVAFWTNLFAKKAVEKPPQTEHIEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccgtgcctttgtcctggccactctcgctgcttccacggcttgggggcatctg
tcatcgccacctgtggtggacaccgtgcatggcaaagtgttggggaagttcgtcagctta
gaaggatttgcacagcctgtggccgttttcctgggaatcccttttgccaagccccctctt
ggatccctgaggtttactccaccacagcctgcagagctgtggagcttcgtgaagaatgcc
acctcgtaccctcctatgtgctcccaagatgctgtggtggggcagtttctctcagaggta
tttacaaaccgaaaggagaacattcctctcaagatgtctgaagactgcctttacctcaat
atttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatccat
ggaggggggttgatggtgggtgcggcatcaacctatgatgggctggcccttgctgcccat
gaaaacgtagtggtggtgaccattcaataccgcctaggcatctggggattcttcagcaca
ggggatgaacacagcccggggaattggggtcacctggaccagctggctgccctgcgctgg
gtccaagacaacattgccagctttggagggaacccaggctctgtgaccatctttggagag
tcagcgggaggagaaagtgtctctgttcttgttttgtctccattggccaagaacctcttc
caccgggccatttctgagagtggcgtggccctcacttctgttctggtgaagaaaggtgat
gtcaagcccttggctgagcaaattgctatcactgctggctgcaaaaccaccacctcagct
gtcatggttcactgcctgcaacagaagacggaagaggagctcttggagacaacattgaaa
atgaaattcttatctctggacttacagggagaccccagagagagtcaaccctttttgggc
actgtgattgatggggtgctgctgctgaaaacacctgaagagcttcaagctgaaaggaag
ttccacactgtcccctacatggttggaattaacaagcaggagtttggctggattattcca
atgttgttgagctctccattctctgaagggaaactggaccagaagacagccatgtcactc
ttgtggaagtcctatccccttgttcaaattgctaaggaactgattccagaagccactgag
aaatacttaggaggaacagatgaccctgtcaaaaagaaagacctgttcctggacttgtta
gcagatgtgatgtttggtgtcccatctgtgattctggcccggaaccacagagatgctgga
gcgccaacctacatgtatgagtttcagtatcgtccaagcttctcatcagacatgaaaccc
aagacggtgataggagaccatggggatgagctcttctccgtctttggggccccattttta
aaagagggtgcctcagaagaggagatcagacttagcaagatggtgatgaaattctgggcc
aactttgctcgcaatggaaaccccaatggggaagggctgccccactggccagcgtacaac
cagaaggaagagtatctgcagattggtgccaacacccaggcggcccagaagctgaaggac
aaagaagtagctttctggaccaacctctttgccaagaaggcagtggagaagccaccccag
acagaacacatagagctgtga

DBGET integrated database retrieval system