KEGG   Pongo abelii (Sumatran orangutan): 100174770Help
Entry
100174770         CDS       T01416                                 

Gene name
PPT1
Definition
palmitoyl-protein thioesterase 1 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pon01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:pon00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:pon04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 306 aa AA seqDB search
MASPGCLWLLAVAFLPWTCASRALQHLDPPAPLPLVIWHGMGDGCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERL
VQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGEHLQLSEEWFYAH
IIPFLG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccggctgcctgtggctcttggctgtcgctttcctgccatggacctgcgct
tctcgggcgctgcagcatctggacccgccggcgccgctgccgttggtgatctggcatggg
atgggagacggctgttgcaatcccttaagcatgggtgctattaaaaaaatggttgagaag
aaaatacctggaatttacgtcttatctttagagattgggaagaccctgatggaggacgtg
gagaacagcttcttcttgaatgtcaattcccaagtaacaacagtatgtcagacacttgct
aaggatcctaaactgcagcaaggctacaatgctatgggattctcccagggaggccaattt
ctgagggcagtggctcagagatgcccttcacctcccatgatcaatctgatctcggttggg
ggacaacatcaaggtgtttttggactccctcgatgcccaggagaaagctctcacatctgt
gacttcatcagaaaaacactgaatgctggagcgtactccaaagttgttcaggaacgcctc
gtgcaagccgaatactggcatgaccccataaaggaggatgtgtatcgcaaccacagcatc
ttcttggcagatataaatcaggagcggggtatcaatgagtcctacaagaaaaacctgatg
gccctgaagaagtttgtgatggtgaaattcctcaatgattccattgtggaccctgtagat
tcggagtggtttggattttacagaagtggccaagccaaggaaaccattcccttacaggag
acctccctgtacacacaggaccgcctggggctaaaggaaatggacaatgcaggacagcta
gtgtttctggctacagaaggggagcatcttcagttgtctgaagaatggttttatgcccac
atcataccattccttggatga

DBGET integrated database retrieval system