KEGG   Pongo abelii (Sumatran orangutan): 100189626Help
Entry
100189626         CDS       T01416                                 

Gene name
ALDH1L1, FDH, FTHFD
Definition
DKFZP469I2021 protein (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100189626 (ALDH1L1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100189626 (ALDH1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 902 aa AA seqDB search
MKIAVIGQSLFGQEVYCHLRKEGHEVVGGFTVPDKDGKADPLGLEAEKDGVPVFKFSRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIINAPQHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQ
KLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMI
LASNFFKGAASSALELTEAELVTAEAVRSVWQRILPNVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTIRI
PHQLFIGGEFVDAEGAKTYETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKI
SARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DEFVRRVVEEVRKMKVGDPLDRDTDHGPQNHHAHLMKLMEYCQRGVKEGATLVCGGNQVP
RPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDVDTVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagtgattggacagagcctgtttggccaggaagtttactgccacctgagg
aaggagggccatgaagtggtgggtgggttcactgttccagacaaggatggaaaggccgac
cccctgggtctggaagctgagaaggatggagtgccagtattcaagttctcccggtggcgt
gcaaaaggacaggctttgcctgatgtggtggcaaaataccaggctttgggggccgagctc
aacgtcctgcccttctgcagccagttcatccccatggagataatcaatgctccccagcat
ggctccatcatctatcacccatcactgctccctaggcaccgaggggcctcggccatcaac
tggaccctcattcacggagataagaaaggggggttttccatcttctgggcggacgatggt
ctggacactggagacctgctgctgcagaaggagtgtgaggtgctcccggacgataccgtg
agcacgctgtacaaccgcttcctcttcccggaaggcatcaaagggatggtgcaggccgtg
aggctgatcgctgagggcaaagcccccagactccctcagcctgaggaaggagccacctat
gaggggattcagaagaaggagacggccaagatcaactgggaccagccagcagaggccatt
cacaactggatccgcgggaatgacaaggtgccgggagcctggacagaggcctgtgaacag
aaactgacatttttcaactcaacgctgaacacttcaggcctggtgcccgagggagatgct
ttgcccatcccaggagcccatcggccaggggtggtcaccaaagcaggactcatcctcttt
gggaatgatgacaaaatgctgctggtgaagaacattcagctggaggatggcaaaatgatc
ctggcctcgaacttctttaagggggcagccagcagtgcccttgagctgacggaggcagag
ctggttactgcggaggctgtgcggagtgtttggcagcggatcctccccaatgtcctggag
gttgaagactccactgatttcttcaagtcaggggccgcgtctgtggacgttgtgaggctg
gtggaggaagtgaaggagctgtgtgatggcctggagttagaaaatgaagatgtgtacatg
gcttccacctttggggacttcatccagctgttagtgaggaagctgcgaggggacgatgag
gagggcgagtgcagcattgactacgtggaaatggcagtgaacaagcgcaccatccgcata
ccccaccagctcttcattgggggggagtttgtggatgccgagggcgccaagacctatgag
accatcaatcccaccgatggaagtgtcatctgccaagtatccctggcccaagtcaccgac
gtcgacaaggcagtggccgctgccaaggatgcctttgagaatggacggtgggggaagatc
agcgcgcgggaccggggccggctgctgtacaggttggcagatctcatggagcagcaccag
gaggagctggccaccatcgaagccctggatgcgggtgccgtctacacgctggccctgaag
acccacgtgggcatgtccatccagaccttccgctactttgccggctggtgtgacaagatc
cagggctccaccatccccatcaaccaggccagacccaaccgcaacctgaccttgaccagg
aaggagcctgttggggtttgtggcatcatcatcccctggaactatcccctgatgatgctg
tcctggaagacagctgcctgcctggctgctgggaacacagtggtgatcaagcctgctcag
gtgaccccactcacagccttgaagtttgcagagctgacattaaaggccggcattcccaaa
ggtgtggttaacgtcctcccaggatctggttccctggtcggccagagactctcagaccat
cctgacgtgaggaaaattgggttcacaggctccacagaggtgggcaagcacatcatgaaa
agctgtgccataagtaacgtgaagaaggtgtccctggagctgggcgggaagtcacccctc
atcatctttgctgactgtgacctcaacaaggctgtgcagatggggatgagctctgttttc
ttcaacaaaggagagaactgcattgcagcaggccggctctttgtggaggactccattcat
gatgagtttgtgcggagggtggtagaagaggtacggaagatgaaggtgggcgacccactg
gacagggacaccgaccacgggccgcagaatcaccatgcccacctgatgaagctgatggag
tactgccagcgcggcgtgaaggaaggggccacactggtctgcggcgggaatcaagtccct
cggccagggttcttctttgagccaactgttttcacagatgtggaggaccacatgttcata
gccaaggaggagtccttcgggcctgtcatgatcatctctcggtttgctgatggggacgtg
gatactgtgctgtctcgggccaatgccacggaatttggcctggcttctggtgtcttcacc
agggacatcaacaaggccctgtatgtcagtgacaagctccaggcaggcactgtgtttgtc
aacacgtacaacaagaccgacgtggccgctcccttcggaggattcaagcagtctggattt
ggcaaagatctaggagaggcggctctgaacgagtacctgcgggtcaagacagtgaccttc
gaatactga

DBGET integrated database retrieval system