KEGG   Pongo abelii (Sumatran orangutan): 100190820Help
Entry
100190820         CDS       T01416                                 

Gene name
PLA2G16, HRASLS3, HREV107, HRSL3
Definition
phospholipase A2, group XVI (EC:3.1.1.4 3.1.1.32)
Orthology
K16817  
HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pon00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:pon00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pon00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:pon00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:pon00592]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:pon04014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 162 aa AA seqDB search
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV
KKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDVIIAASAAGMGLAAMSLIGVMFSRNKRQKQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcccattccagagcctaagcctggagacctgattgagatttttcgccctttc
tatagacactgggccatctacgttggcgatggatatgtggttcatctggcccctccaagt
gaggtcgcaggagctggtgcagccagtgtcatgtccgccctgactgacaaggccatcgtg
aagaaggaattgctgtatgacgtggccgggagtgacaagtaccaagtcaacaacaaacac
gatgacaagtactcgccgctgccctgcagcaaaatcatccagcgggcggaggagctggtg
gggcaggaggtgctctacaagctgaccagcgagaactgcgagcactttgtgaatgagctg
cgctatggagtcgcccgcagtgaccaggtcagagatgtcatcatcgctgcaagcgctgca
ggaatgggcttggcagccatgagccttattggagtcatgttctcaagaaacaagcgacaa
aagcaataa

DBGET integrated database retrieval system