KEGG   Pongo abelii (Sumatran orangutan): 100190820Help
Entry
100190820         CDS       T01416                                 

Gene name
PLA2G16
Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon00590  Arachidonic acid metabolism
pon00591  Linoleic acid metabolism
pon00592  alpha-Linolenic acid metabolism
pon01100  Metabolic pathways
pon04014  Ras signaling pathway
pon04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100190820 (PLA2G16)
   00565 Ether lipid metabolism
    100190820 (PLA2G16)
   00590 Arachidonic acid metabolism
    100190820 (PLA2G16)
   00591 Linoleic acid metabolism
    100190820 (PLA2G16)
   00592 alpha-Linolenic acid metabolism
    100190820 (PLA2G16)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100190820 (PLA2G16)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100190820 (PLA2G16)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100190820 (PLA2G16)
    3.1.1.32  phospholipase A1
     100190820 (PLA2G16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Calici_PP_N Peptidase_C97
Motif
Other DBs
NCBI-GeneID: 100190820
NCBI-ProteinID: NP_001128980
UniProt: Q5R611
AA seq 162 aa AA seqDB search
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV
KKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDVIIAASAAGMGLAAMSLIGVMFSRNKRQKQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcccattccagagcctaagcctggagacctgattgagatttttcgccctttc
tatagacactgggccatctacgttggcgatggatatgtggttcatctggcccctccaagt
gaggtcgcaggagctggtgcagccagtgtcatgtccgccctgactgacaaggccatcgtg
aagaaggaattgctgtatgacgtggccgggagtgacaagtaccaagtcaacaacaaacac
gatgacaagtactcgccgctgccctgcagcaaaatcatccagcgggcggaggagctggtg
gggcaggaggtgctctacaagctgaccagcgagaactgcgagcactttgtgaatgagctg
cgctatggagtcgcccgcagtgaccaggtcagagatgtcatcatcgctgcaagcgctgca
ggaatgggcttggcagccatgagccttattggagtcatgttctcaagaaacaagcgacaa
aagcaataa

DBGET integrated database retrieval system