KEGG   Pongo abelii (Sumatran orangutan): 100294619Help
Entry
100294619         CDS       T01416                                 

Gene name
CREB1
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    100294619 (CREB1)
   04022 cGMP - PKG signaling pathway
    100294619 (CREB1)
   04151 PI3K-Akt signaling pathway
    100294619 (CREB1)
   04152 AMPK signaling pathway
    100294619 (CREB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    100294619 (CREB1)
  Endocrine system
   04911 Insulin secretion
    100294619 (CREB1)
   04915 Estrogen signaling pathway
    100294619 (CREB1)
   04918 Thyroid hormone synthesis
    100294619 (CREB1)
   04916 Melanogenesis
    100294619 (CREB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100294619 (CREB1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100294619 (CREB1)
  Nervous system
   04725 Cholinergic synapse
    100294619 (CREB1)
   04728 Dopaminergic synapse
    100294619 (CREB1)
  Development
   04380 Osteoclast differentiation
    100294619 (CREB1)
  Environmental adaptation
   04710 Circadian rhythm
    100294619 (CREB1)
   04713 Circadian entrainment
    100294619 (CREB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100294619 (CREB1)
   05215 Prostate cancer
    100294619 (CREB1)
  Neurodegenerative diseases
   05016 Huntington's disease
    100294619 (CREB1)
  Substance dependence
   05030 Cocaine addiction
    100294619 (CREB1)
   05031 Amphetamine addiction
    100294619 (CREB1)
   05034 Alcoholism
    100294619 (CREB1)
  Infectious diseases
   05152 Tuberculosis
    100294619 (CREB1)
   05166 HTLV-I infection
    100294619 (CREB1)
   05161 Hepatitis B
    100294619 (CREB1)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100294619 (CREB1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100294619 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 341 aa AA seqDB search
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYCHKSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactctagtgcagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcgcctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagctgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagacgtacaaacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggtccgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaaacacttaaggacctttactgccacaaatca
gattaa

DBGET integrated database retrieval system