KEGG   Pongo abelii (Sumatran orangutan): 100294622Help
Entry
100294622         CDS       T01416                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100294622 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    100294622 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100294622 (CCNH)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100294622 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 325 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLRE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEIAKLWHQSKVHTYH
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagcggcactggactttctccagtgaggagcagctggca
agactgcgggccgacgccaaccgcaaattcagatgcaaagccgtggccaacgggaaggtt
cttccgaatgatccagtctttcttgagcctcatgaagaaatgacactctgcaaatactat
gagaaaaggttattggaattctgttcggtgtttaagccagcaatgccaaggtctgttgtg
ggtacggcttgtatgtatttcaaacgtttttaccttaataactcagtaatggaatatcac
cccaggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgta
tctagtcctcagtttgttggaaaccttcgggagagtcctcttggacaggagaaggcactt
gaacagatactggaatatgaactacttcttatacagcaacttaatttccaccttattgtc
cacaatccttacagaccatttgagggcttcctcatcgacttaaagacccgctatcccata
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagaattgcattg
acggatgcttaccttttgtacacaccttcccaaattgccctgactgccattttatctagt
gcctccagggctggaattactatggaaagttatttatcagagagtctgatgctgagagag
aacagaacttgcctgtcacagttactagatataatgaaaagcatgagaaacttagtaaaa
aagtatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagcgatgc
cattctgctgagcttgcacttaacgtaatcacgaagaagaggaaaggctatgaagatgat
gattacgtctcaaagaaatccaaacatgaggagatcgccaaactttggcatcagagcaag
gtccacacttatcactga

DBGET integrated database retrieval system