KEGG   Pongo abelii (Sumatran orangutan): 100431215Help
Entry
100431215         CDS       T01416                                 

Gene name
CES2
Definition
cocaine esterase
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100431215 (CES2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100431215 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100431215 (CES2)
    3.1.1.84  cocaine esterase
     100431215 (CES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 647 aa AA seqDB search
MPKGPGQKGSGRARACLSLDPHPPMTAQSCSPARPTFPCPSQRTPPTPCPVQTPRLGKAL
IHGWTDPGQPLGEQQRVHPQRTETSEPTMRLHRLRARLSAVAFGLLLLLVRGQGQDSASP
IRTTHAGQVLGSLVHVKGTDAAVQTFLGIPFAKPPLGLLRFAPPEPPESWSGVRDGTTHP
AMCLQDLTAVESEFLSQFNVTFPSIPMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGGLV
FGMASMYDGSMLAALEDVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVRQNI
AHFGGNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISM
VVANLSACDHIDSEALVGCLRGKSKEEILAINKPFKIIPGVVDGIFLPRHPQELLASADF
QPVPSIIGVNSDEFGWIIPKVMRIYDTQKEMDREGSQAALQKMLTLMMLPPTFGDLLMEE
YIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQRSRAPVYFYEFQHQPSWVKNIRPPH
VKADHGDEIPFVFRSFFGGNYIKLTEEEEQLSRKMMKYWANFARNGNPNGKGLPHWPLFD
QEEQYLQLNLQSAVGRALKAHRLQFWKKARPQEIQELKEPEERHTEL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggggcccgggcagaagggaagtggccgtgcccgggcctgcctgtcactagat
ccccatccacctatgactgctcagtcctgctctcctgccagacccacctttccctgccca
agccagcgcaccccgcccactccctgcccagtccaaactccaaggctgggcaaggcactg
atccacggctggaccgacccggggcagcctctgggtgaacagcagcgtgtccacccgcag
agaaccgagaccagcgagccgaccatgcggctgcaccgacttcgcgcgcggctgagcgcg
gtggcttttgggctcctgttgcttcttgtccggggccagggccaggactctgccagtccc
atccggaccacacacgcagggcaagtgctggggagtcttgtccacgtgaagggcaccgat
gccgcagtccaaaccttcctgggaattccctttgccaagccacctctaggtctgctgcga
tttgcacctcctgagccccctgaatcttggagtggtgtgagggatggaaccacccatccg
gccatgtgtctgcaggacctcaccgcagtggagtcagagtttcttagccagttcaatgtg
accttcccttccatccccatgtccgaggactgcctgtacctcagcatctacacgccggcc
catagccatgaaggctctaacctgccggtgatggtgtggatccacggtggtgggctcgtt
tttggcatggcttccatgtatgatggttccatgctggccgccttggaggacgtggtggtg
gtcatcatccagtaccgcctgggtgtcctgggcttcttcagcactggagacaagcatgca
accggcaactggggctacctggaccaagtggctgcactacgctgggtccggcagaatatc
gcccactttggaggcaaccctgaccgtgtcaccatttttggcgagtctgcgggtggcacg
agtgtgtcttcgcttgttgtgtcccccatatcccaaggactgttccatggagccatcatg
gagagtggcgtggccctcctgcccggcctcattgccagctcggctgatgtcatctccatg
gtagtggccaatctgtctgcctgtgaccacattgactctgaggccctggtgggctgcctg
cggggcaagagtaaagaggagattcttgcaattaacaagcctttcaagataatccccgga
gtggtggatgggatcttcctgcccaggcacccccaggagctgctggcttctgccgacttt
caacctgtccccagcatcattggtgtcaacagcgatgaatttggctggatcatccccaag
gtcatgaggatctatgatacccagaaggaaatggacagagagggctcccaggctgctctg
cagaaaatgttaacgctcatgatgttgcctcctacatttggtgacctgctgatggaggag
tacattggggacaatggggatccccagaccctccaagcccagttccaggagatgatggcg
gactccatgttcgtgatccccgcactccaagtagcacattttcagcgttcccgggcccct
gtgtacttctacgagttccagcatcagccgagctgggtcaagaacatcaggccgccgcac
gtgaaggcagaccatggtgatgagattccttttgttttcagaagtttcttcgggggcaac
tacattaaactcactgaggaggaggagcagctaagcaggaagatgatgaagtactgggcc
aactttgcgcgaaacgggaaccccaacggcaagggtctgccacactggccgctgtttgac
caggaggagcaatacctgcagctgaacctacagtctgcggtgggccgggctctgaaggcc
cacaggctccagttctggaagaaggcgcggccccaggagatccaggagctcaaggagcct
gaagagagacacacagagctgtag

DBGET integrated database retrieval system