KEGG   Pongo abelii (Sumatran orangutan): 100431441Help
Entry
100431441         CDS       T01416                                 

Gene name
USP31, USP48
Definition
ubiquitin specific peptidase 31
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 1330 aa AA seqDB search
MSKVTAPGSGPPAASGKEKRSFSKRLFRSGRAGGGGAGGPGASGPAAPSSPSSARSVGSF
MSRVLKTLSTLSHLSSEGAAPDRGGLRSCFPPGPAAVPTPPPCPPPPASPAPPACAAEPV
PGVAGLRNHGNTCFMNATLQCLSNTELFAEYLALGQYRAGRPEPSLDPEQPTGGGAQGQG
EVTEQLAHLVRALWTLEYTPQHSRDFKTIVSKNALQYRGNSQHDAQEFLLWLLDRVHEDL
NHSVKQSGQPPLKPFVQELFQAPIRSSLACPHCQKQSNTFDPFLCISLPIPLPHTRPLYV
TVVYQGKCSHCMRIGVAVPLSGTVARLREAVSVETKIPTDQIVLTEMYYDGFHRSFCDTD
DLETVHESDCIFAFETPEIFRPEGILSQRGIHLNNNLNHLKFGLDYHRLSSPTQTATKQG
KMDLPTSRAGSDKIVLLVCNRACTGQQGKRFGLPFVLHLEKTIAWDLLQKEILEKMKYFL
RPTVCIQVCPFSLRVVSVVGITYLLPQEEQPLCHPTVERALKSCGPGGTAHVKLVVEWDK
ETRDFLFVNTEDEYIPDAESVRLQRERHHQPQTCTLSQCFQLYTKEERLAPDDAWRCPHC
KQLQQGSITLSLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLTGLDMTPHVVKRSQSS
WSLPSHWSPWRRPYGLGRDPEDYIYDLYAVCNHHGTMQGGHYTAYCKNSVDGLWYCFDDS
DVQQLSEDEVCTQTAYILFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGSKPASVT
SAASSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENC
MRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSVSCFGSLRNLSSSY
QEPSDSHSRREHKAVGRAPLAVMEGVFKDESDTRRLNSSVVDTQSKHSAQGDRLPPLSGP
FDNNNQIAYVDQSDSVDSSPVKEVKPPSHPGSLAKKPESTTKRSPNSKGTSEPEKSLRKG
RPALASQESSLSSTSPSSPLPVKVSLKPSRSRSKADSSSRGSGRHSSPGPAQPKKESSPK
SQDSMSSPSPQKQKSASALTYTASSTSAKKASGPATRSPFPPGKSRTSDRSLSREGSRQS
LGSDRASATSTSKPNSPRVSQARAGEGRGAGKHVRSSSMASLRSPSTSIKSGLKRDSKSE
DKGLSFFKSALRQKETRRSTDLGKTALLSKKAGGSSVKSVCKNTGDDKAEKGHQPLASQQ
PNANTTGKEQLVSKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQ
TSARPSHKPQ
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtaacggcgcccgggtccgggccgccggcggcgagtgggaaggagaagcgc
tccttcagcaagcggctgtttcggagcggccgcgctggtggcggcggcgcggggggcccc
ggggcgtccgggccggccgcgccctcctcgccctcttctgcacgctcggtgggcagcttc
atgagccgcgttctcaagacgctgtccacgctctcgcaccttagctctgagggcgccgcc
ccggaccgcggcggcctccgcagctgcttcccgccggggccggccgccgtgcccacgccg
ccgccgtgcccgccgccgcccgcctctcccgcgccgcccgcttgcgctgccgagccggtg
cccggcgtggcggggctccgcaaccacggcaacacgtgcttcatgaacgccacgctgcag
tgcctcagcaacaccgagctcttcgccgagtacctggcgctgggccagtaccgggcgggg
cggcctgagccctcgcttgaccccgagcagcctacgggcggcggcgcgcagggccagggc
gaggtcactgagcagctggcgcacctggtgcgggccctctggaccctggagtacaccccg
cagcacagccgcgacttcaagactattgtgtcaaagaatgcactgcagtaccggggaaat
tcccagcatgatgcccaggagtttctgctgtggcttttggaccgagttcatgaagacctc
aaccattcagtgaagcagagtggccagcctcctctgaagccctttgtacaagaacttttt
caagccccaataagatcttctttggcgtgtcctcattgtcagaaacagagcaacactttt
gatcctttcctttgcatttctttgccaattcctctaccccacacaaggcctctctatgtc
actgtagtgtatcaaggcaaatgttctcactgcatgaggattggtgtggccgtacctctg
tctgggactgttgccagacttcgggaagcagtgtctgtggaaacaaagatccccactgat
cagattgtgttaacagaaatgtactatgatgggttccatcgttccttttgtgatacagac
gacctggaaacagtccatgaaagcgactgcatttttgcctttgagactcccgaaatattt
aggcctgaaggaattctcagtcaaagaggaattcatttaaacaacaacctaaaccacttg
aaatttggcttggattatcatagactgtcttctcctacacaaacagcaacaaagcaaggg
aaaatggatttgcccacctcaagagcaggcagcgacaagattgtcctgttggtgtgtaac
cgagcctgcactgggcaacaagggaaaagatttggactgccttttgtgctgcacttagag
aagacaatagcttgggaccttctgcagaaggaaatcttggagaagatgaagtatttcttg
aggcccacggtttgcattcaggtgtgtccattcagcttgcgtgtggtcagtgttgttgga
ataacgtatttgctgccccaggaggagcagcccttgtgccacccaacagtagaaagggca
ttaaaatcttgtggaccaggtggcaccgctcatgtgaaattagtagtcgagtgggacaag
gagacaagagatttcttgtttgtaaatactgaagatgagtatatccctgatgcagaaagt
gttcgtctgcaaagggagcgtcatcatcagcctcaaacctgcactttatcccagtgtttc
caactgtacaccaaagaggagcggcttgcccccgatgatgcctggcgttgcccacactgt
aagcagctgcagcagggaagcattacgttaagcctctggactctgcctgatgtgcttatt
atacatctaaagagatttcggcaggaaggagacaggcgcatgaaacttcagaacatggtc
aagttccccttgactggcctggacatgacacctcatgtggttaagaggagccagagcagc
tggagtttgccatcccattggtccccgtggagacggccctatggactcgggagggaccct
gaggactacatctatgacctgtatgctgtgtgcaatcaccatggcaccatgcaagggggg
cactacacagcatactgtaagaactctgtggatggcctctggtactgcttcgatgacagc
gatgtgcagcagctgtcagaagatgaggtctgcacgcagacagcatacatcctcttctac
cagaggcggacagccatcccgtcatggtcagccaacagctcggtggcaggctccacgagt
tcttccctgtgtgaacactgggtgagccgactcccgggcagcaagccagccagcgtgacc
tctgcagcttcctccagacgcacctccctggcatcactctctgagtccgtggagatgact
ggagaaaggagtgaagatgatggaggcttttcaactcgaccatttgtgagaagtgtccag
cgtcagagtttgtcatccagatcttctgtcaccagccccttggccgtcaatgaaaattgc
atgagaccttcatggtccctgtccgctaagctgcagatgcgctccaattctccatcccga
ttttcaggggattcgccaattcacagctctgcttccaccttggagaagattggggaggca
gcggatgacaaggtctctgtctcttgctttggtagcttgcggaacctttctagcagttac
caggaaccaagcgacagtcatagtcgccgtgagcacaaggctgtgggccgggcccctctg
gctgtcatggaaggtgtgttcaaagatgaatcggacacccgcagattgaactccagtgtc
gtagatacacagagcaaacattcagcacaaggggaccgcctgcccccgctctctggtcca
tttgataacaataatcagatcgcttatgtggatcagagcgactccgtagacagctctcca
gtcaaagaggtgaaaccccccagccacccaggctcactcgcaaagaaaccagagagcaca
actaagagatcccccaattccaaaggcacttctgagccagagaaaagcttgcggaagggg
agaccggccttggcaagccaggagtcttccctttcaagtacatccccttcttctcctctt
cctgtaaaagtctctctaaagccctcccgctcccgcagcaaagcagattcttcttccagg
ggcagtggacggcattcatcccctggccctgcccaacccaaaaaggagtcatccccgaaa
tctcaggactccatgtcatctccttcgccacagaagcagaagtcagcatcggccctcacc
tacactgcttcctccacatctgccaaaaaggcctcgggccctgccacaaggagccctttc
ccacctgggaagagcaggacttcagaccggagcttgagtagagagggctccaggcaaagc
ttgggttctgacagagccagcgccacctccacctccaaacccaactcccctcgggtgagc
caggcccgagcaggggagggcaggggggccgggaagcacgtgcggagctcctccatggcc
agcctgcgctcccccagcacaagcatcaagtctggtttgaagagggacagcaagtctgag
gacaaggggctgtccttcttcaaatcagccttgagacagaaggaaacccggcgctcgacg
gatcttggcaagacagccttgctctctaaaaaggctggtgggagctctgttaagtccgtc
tgtaagaacaccggggacgacaaggcagagaaaggccaccagcctctagcttcccagcag
ccaaatgcaaatacaacgggaaaagagcagcttgtctccaaggaccctgcttctgccaaa
cattccctgctgtccgctcgcaaatccaagtcttcccaactagactctggagttccctca
tctccgggtggcaggcagtctgcagagaaatcctcaaaaaagttatcttctagcatgcaa
acctctgcacggccttctcataaacctcagtga

DBGET integrated database retrieval system