KEGG   Pongo abelii (Sumatran orangutan): 100431441Help
Entry
100431441         CDS       T01416                                 

Gene name
USP31, USP48
Definition
ubiquitin specific peptidase 31
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100431441 (USP31)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100431441 (USP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 1320 aa AA seqDB search
MSKVTAPGSGPPAASGKEKRSFSKRLFRSGRAGGGGAGGPGASGPAAPSSPSSARSVGSF
MSRVLKTLSTLSHLSSEGAAPDRGGLRSCFPPGPAAVPTPPPCPPPPASPAPPACAAEPV
PGVAGLRNHGNTCFMNATLQCLSNTELFAEYLALGQYRAGRPEPSLDPEQPTGGGAQGQG
EVTEQLAHLVRALWTLEYTPQHSRDFKTIVSKNALQYRGNSQHDAQEFLLWLLDRVHEDL
NHSVKQSGQPPLKFGSSLACPHCQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKCSH
CMRIGVAVPLSGTVARLREAVSVETKIPTDQIVLTEMYYDGFHRSFCDTDDLETVHESDC
IFAFETPEIFRPEGILSQRGIHLNNNLNHLKFGLDYHRLSSPTQTATKQGKMDLPTSRAG
SDKIVLLVCNRACTGQQGKRFGLPFVLHLEKTIAWDLLQKEILEKMKYFLRPTVCIQVCP
FSLRVVSVVGITYLLPQEEQPLCHPTVERALKSCGPGGTAHVKLVVEWDKETRDFLFVNT
EDEYIPDAESVRLQRERHHQPQTCTLSQCFQLYTKEERLAPDDAWRCPHCKQLQQGSITL
SLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLTGLDMTPHVVKRSQSSWSLPSHWSPW
RRPYGLGRDPEDYIYDLYAVCNHHGTMQGGHYTAYCKNSVDGLWYCFDDSDVQQLSEDEV
CTQTAYILFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGSKPASVTSAASSRRTSL
ASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAK
LQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSVSCFGSLRNLSSSYQEPSDSHSRR
EHKAVGRAPLAVMEGVFKDESDTRRLNSSVVDTQSKHSAQGDRLPPLSGPFDNNNQIAYV
DQSDSVDSSPVKEVKPPSHPGSLAKKPESTTKRSPNSKGTSEPEKSLRKGRPALASQESS
LSSTSPSSPLPVKVSLKPSRSRSKADSSSRGSGRHSSPGPAQPKKESSPKSQDSMSSPSP
QKQKSASALTYTASSTSAKKASGPATRSPFPPGKSRTSDRSLSREGSRQSLGSDRASATS
TSKPNSPRVSQARAGEGRGAGKHVRSSSMASLRSPSTSIKSGLKRDSKSEDKGLSFFKSA
LRQKETRRSTDLGKTALLSKKAGGSSVKSVCKNTGDDKAEKGHQPLASQQPNANTTGKEQ
LVSKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSHKPQ
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtaacggcgcccgggtccgggccgccggcggcgagtgggaaggagaagcgc
tccttcagcaagcggctgtttcggagcggccgcgctggtggcggcggcgcggggggcccc
ggggcgtccgggccggccgcgccctcctcgccctcttctgcacgctcggtgggcagcttc
atgagccgcgttctcaagacgctgtccacgctctcgcaccttagctctgagggcgccgcc
ccggaccgcggcggcctccgcagctgcttcccgccggggccggccgccgtgcccacgccg
ccgccgtgcccgccgccgcccgcctctcccgcgccgcccgcttgcgctgccgagccggtg
cccggcgtggcggggctccgcaaccacggcaacacgtgcttcatgaacgccacgctgcag
tgcctcagcaacaccgagctcttcgccgagtacctggcgctgggccagtaccgggcgggg
cggcctgagccctcgcttgaccccgagcagcctacgggcggcggcgcgcagggccagggc
gaggtcactgagcagctggcgcacctggtgcgggccctctggaccctggagtacaccccg
cagcacagccgcgacttcaagactattgtgtcaaagaatgcactgcagtaccggggaaat
tcccagcatgatgcccaggagtttctgctgtggcttttggaccgagttcatgaagacctc
aaccattcagtgaagcagagtggccagcctcctctgaagtttggatcttctttggcgtgt
cctcattgtcagaaacagagcaacacttttgatcctttcctttgcatttctttgccaatt
cctctaccccacacaaggcctctctatgtcactgtagtgtatcaaggcaaatgttctcac
tgcatgaggattggtgtggccgtacctctgtctgggactgttgccagacttcgggaagca
gtgtctgtggaaacaaagatccccactgatcagattgtgttaacagaaatgtactatgat
gggttccatcgttccttttgtgatacagacgacctggaaacagtccatgaaagcgactgc
atttttgcctttgagactcccgaaatatttaggcctgaaggaattctcagtcaaagagga
attcatttaaacaacaacctaaaccacttgaaatttggcttggattatcatagactgtct
tctcctacacaaacagcaacaaagcaagggaaaatggatttgcccacctcaagagcaggc
agcgacaagattgtcctgttggtgtgtaaccgagcctgcactgggcaacaagggaaaaga
tttggactgccttttgtgctgcacttagagaagacaatagcttgggaccttctgcagaag
gaaatcttggagaagatgaagtatttcttgaggcccacggtttgcattcaggtgtgtcca
ttcagcttgcgtgtggtcagtgttgttggaataacgtatttgctgccccaggaggagcag
cccttgtgccacccaacagtagaaagggcattaaaatcttgtggaccaggtggcaccgct
catgtgaaattagtagtcgagtgggacaaggagacaagagatttcttgtttgtaaatact
gaagatgagtatatccctgatgcagaaagtgttcgtctgcaaagggagcgtcatcatcag
cctcaaacctgcactttatcccagtgtttccaactgtacaccaaagaggagcggcttgcc
cccgatgatgcctggcgttgcccacactgtaagcagctgcagcagggaagcattacgtta
agcctctggactctgcctgatgtgcttattatacatctaaagagatttcggcaggaagga
gacaggcgcatgaaacttcagaacatggtcaagttccccttgactggcctggacatgaca
cctcatgtggttaagaggagccagagcagctggagtttgccatcccattggtccccgtgg
agacggccctatggactcgggagggaccctgaggactacatctatgacctgtatgctgtg
tgcaatcaccatggcaccatgcaaggggggcactacacagcatactgtaagaactctgtg
gatggcctctggtactgcttcgatgacagcgatgtgcagcagctgtcagaagatgaggtc
tgcacgcagacagcatacatcctcttctaccagaggcggacagccatcccgtcatggtca
gccaacagctcggtggcaggctccacgagttcttccctgtgtgaacactgggtgagccga
ctcccgggcagcaagccagccagcgtgacctctgcagcttcctccagacgcacctccctg
gcatcactctctgagtccgtggagatgactggagaaaggagtgaagatgatggaggcttt
tcaactcgaccatttgtgagaagtgtccagcgtcagagtttgtcatccagatcttctgtc
accagccccttggccgtcaatgaaaattgcatgagaccttcatggtccctgtccgctaag
ctgcagatgcgctccaattctccatcccgattttcaggggattcgccaattcacagctct
gcttccaccttggagaagattggggaggcagcggatgacaaggtctctgtctcttgcttt
ggtagcttgcggaacctttctagcagttaccaggaaccaagcgacagtcatagtcgccgt
gagcacaaggctgtgggccgggcccctctggctgtcatggaaggtgtgttcaaagatgaa
tcggacacccgcagattgaactccagtgtcgtagatacacagagcaaacattcagcacaa
ggggaccgcctgcccccgctctctggtccatttgataacaataatcagatcgcttatgtg
gatcagagcgactccgtagacagctctccagtcaaagaggtgaaaccccccagccaccca
ggctcactcgcaaagaaaccagagagcacaactaagagatcccccaattccaaaggcact
tctgagccagagaaaagcttgcggaaggggagaccggccttggcaagccaggagtcttcc
ctttcaagtacatccccttcttctcctcttcctgtaaaagtctctctaaagccctcccgc
tcccgcagcaaagcagattcttcttccaggggcagtggacggcattcatcccctggccct
gcccaacccaaaaaggagtcatccccgaaatctcaggactccatgtcatctccttcgcca
cagaagcagaagtcagcatcggccctcacctacactgcttcctccacatctgccaaaaag
gcctcgggccctgccacaaggagccctttcccacctgggaagagcaggacttcagaccgg
agcttgagtagagagggctccaggcaaagcttgggttctgacagagccagcgccacctcc
acctccaaacccaactcccctcgggtgagccaggcccgagcaggggagggcaggggggcc
gggaagcacgtgcggagctcctccatggccagcctgcgctcccccagcacaagcatcaag
tctggtttgaagagggacagcaagtctgaggacaaggggctgtccttcttcaaatcagcc
ttgagacagaaggaaacccggcgctcgacggatcttggcaagacagccttgctctctaaa
aaggctggtgggagctctgttaagtccgtctgtaagaacaccggggacgacaaggcagag
aaaggccaccagcctctagcttcccagcagccaaatgcaaatacaacgggaaaagagcag
cttgtctccaaggaccctgcttctgccaaacattccctgctgtccgctcgcaaatccaag
tcttcccaactagactctggagttccctcatctccgggtggcaggcagtctgcagagaaa
tcctcaaaaaagttatcttctagcatgcaaacctctgcacggccttctcataaacctcag
tga

DBGET integrated database retrieval system