KEGG   Pongo abelii (Sumatran orangutan): 100431443Help
Entry
100431443         CDS       T01416                                 

Gene name
MLYCD
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100431443 (MLYCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100431443 (MLYCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100431443 (MLYCD)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100431443 (MLYCD)
Enzymes [BR:pon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100431443 (MLYCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 577 aa AA seqDB search
MALLSEKLHKSLFQFSAAVKRPHGPNNRVPVSPFCFMKAPVKMVSPSQILLGRWESREAN
GSARLWQGRGPVFQVERRCAGRTAVSYISRHFPMVTELQGSRERDAHKVPAPLPEGPRMT
DSYSKGGHVAEAGQAECFAQCRYQDASSLLMEKCESGNWIQLMDKADGENEDCVQRRKDK
GKRKDFWFQALMPILFKQQPEGGRWLLQAEDRLRTTLVPRYRGLFHHISKLDGGVRFLVQ
LRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAE
AVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKERPPSE
TEEKNKIAAAIFYSISLTQQGLQGVELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTK
WLLGLLNSQTKEHGRNELFTDLECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQT
PLMRLCAWYLYGEKHRGYALNPVANFHLQNGAVLWRINWMADVSLKGITGSCGLMANYRY
FLEETGPNSTSYLGSKNIKASEQVLSLVAQFQRNSKL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgctgtctgagaaactgcacaagtctttatttcagttttccgctgctgtgaag
aggccacacgggcccaacaatagggttccagtctctccattctgcttcatgaaagcaccc
gttaaaatggtcagtccaagccagatcctccttggaagatgggagagcagagaagccaat
ggcagtgctcgcctctggcagggcagaggtcccgtttttcaagtagaacgaaggtgtgca
ggcaggacagccgtgtcctacatttcccgccatttccccatggtgacggagctgcagggg
tccagggaaagggacgctcacaaggtccccgcaccgcttcccgagggtcccagaatgaca
gattcgtattctaaaggtggccacgtggctgaggcaggccaagcagagtgctttgcccag
tgtcggtaccaagatgcctcttccttactcatggaaaaatgtgaatctggaaactggatc
cagctcatggacaaagccgacggagagaatgaagactgtgtgcagagaaggaaagacaag
gggaagaggaaggatttctggttccaggccctgatgcctattcttttcaagcagcagccg
gaaggcgggcggtggcttttgcaggccgaggaccggctgcgcacgacgctggtgccgcgc
tatcgcggcctcttccaccacatcagcaagctggacggcggcgtgcgcttcctggtgcag
ctgcgggccgatctgctggaggcgcaggcccttaagctggtggaggggccggacgtccgg
gaaatgaatggggtgctgaagggaatgctgtcagaatggttttcctctgggttcctgaac
ctagaacgggttacctggcattcaccgtgtgaagtgcttcagaaaatcagtgaggctgag
gctgtgcatcctgtaaaaaattggatggacatgaagcgccgcgttgggccctacagaaga
tgttacttcttttctcactgttcgacccctggggagcccctggtcgttttgcacgtggca
ctgactggtgacatctccagcaacatccaggcaatcgtgaaagaacgtcctccatcagaa
acagaagagaagaacaaaattgctgctgccatcttttattccatcagtttgacccagcag
ggactccaaggggtggagctgggaacattcctcataaagcgagtcgtcaaggagttgcag
agagagtttcctcaccttggggtgttttcgagtctgtcacctatacctggattcaccaaa
tggcttctggggcttctgaactcgcaaacgaaggagcacgggaggaatgaactctttaca
gatttggaatgtaaggaaatctcggagatcacaggtggccccattaatgagaccctcaag
ctcctcctcagcagcagcgagtgggtgcagtcggagaagctggtgcgggcgctgcagact
ccgctgatgaggctgtgcgcctggtacctgtatggagagaagcaccgcggctacgcgctg
aacccggtggccaacttccaccttcagaacggggcggtgttatggcgcatcaactggatg
gcggatgtgagcctcaaaggcatcaccggctcctgcggcctgatggccaactaccgctac
ttcctggaggagacaggccccaacagcacctcctacctcggctccaagaacatcaaagcc
tctgagcaggtcctcagcctagtggcccagtttcagaggaacagcaagctctga

DBGET integrated database retrieval system