KEGG   Pongo abelii (Sumatran orangutan): 100431483Help
Entry
100431483         CDS       T01416                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04071  Sphingolipid signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04650  Natural killer cell mediated cytotoxicity
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
pon05416  Viral myocarditis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100431483 (RAC2)
   04015 Rap1 signaling pathway
    100431483 (RAC2)
   04010 MAPK signaling pathway
    100431483 (RAC2)
   04310 Wnt signaling pathway
    100431483 (RAC2)
   04370 VEGF signaling pathway
    100431483 (RAC2)
   04071 Sphingolipid signaling pathway
    100431483 (RAC2)
   04024 cAMP signaling pathway
    100431483 (RAC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100431483 (RAC2)
   04520 Adherens junction
    100431483 (RAC2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100431483 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100431483 (RAC2)
   04662 B cell receptor signaling pathway
    100431483 (RAC2)
   04664 Fc epsilon RI signaling pathway
    100431483 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    100431483 (RAC2)
   04670 Leukocyte transendothelial migration
    100431483 (RAC2)
   04062 Chemokine signaling pathway
    100431483 (RAC2)
  Development
   04360 Axon guidance
    100431483 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100431483 (RAC2)
   05231 Choline metabolism in cancer
    100431483 (RAC2)
   05210 Colorectal cancer
    100431483 (RAC2)
   05212 Pancreatic cancer
    100431483 (RAC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100431483 (RAC2)
   05416 Viral myocarditis
    100431483 (RAC2)
GTP-binding proteins [BR:pon04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100431483 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 100431483
NCBI-ProteinID: XP_002831136
Ensembl: ENSPPYG00000011791
UniProt: H2P4A5
Position
22
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRTCSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaaatgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaatgcctttcccggagagtacatccccaccgtgtttgacaactat
tcagccaacgtgatggtggacagcaagccagtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccgctctcctacccacagacggatgtcttcctcatc
tgcttctccctcgtcagcccagcctcttatgagaacgtccgcgccaagtggttcccggaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggagattgactcggtgaaatacctggagtgctcagccctc
acccagagaggcctgaaaactgtgttcgacgaggccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcacctgcagcctcctctag

DBGET integrated database retrieval system