KEGG   Pongo abelii (Sumatran orangutan): 100431805Help
Entry
100431805         CDS       T01416                                 

Gene name
DLAT
Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00020  Citrate cycle (TCA cycle)
pon00620  Pyruvate metabolism
pon01100  Metabolic pathways
pon01200  Carbon metabolism
Module
pon_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100431805 (DLAT)
   00020 Citrate cycle (TCA cycle)
    100431805 (DLAT)
   00620 Pyruvate metabolism
    100431805 (DLAT)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     100431805 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 100431805
NCBI-ProteinID: XP_002822510
Ensembl: ENSPPYG00000003872
UniProt: H2NFA4
Position
11
AA seq 647 aa AA seqDB search
MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVTSRSGPAPARRNSVTTGYGGVRALCG
WTPSSGATPRNRLLLQLLGSPGRRCYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKIN
EGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYT
LDSSAAPTPQAAPTPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
SAFADYRPTEVTDLKPQAPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPL
AKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPAGVF
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFI
IKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIAND
VVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPA
DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtctgtgcgcgacgggcccagaatgtagccccatgggcgggactcgaggct
cggtggacggccttgcaggaggtacccggaactccacgagtgacctcgcgatctggcccg
gctccggctcgtcgcaacagcgtgactacagggtatggcggggtccgggcactgtgcggc
tggacccccagttctggggccacgccgcggaaccgcttactgctgcagcttttggggtcg
cccggtcgccgctgttacagtcttcccccgcatcaaaaggttccattgccttctctttcc
cccacaatgcaggcaggcaccatagcccgttgggaaaaaaaagagggggacaaaatcaat
gaaggtgacctaattgcagaggttgaaactgataaagccactgttggatttgagagcctt
gaggagtgttacatggcaaagatacttgttgctgaaggtaccagggatgttcccatcgga
gcgatcatctgtatcaccgttggcaagcctgaggatattgaggcctttaaaaattataca
ttggattcctcagcagcacctaccccacaagcggccccaacaccaacccctgctgccact
gcttcgccacctacaccttctgctcaggctcctggtagctcatatccccctcacatgcag
gtacttcttcctgccctctctcccaccatgaccatgggcacagttcagagatgggaaaaa
aaagtgggtgagaagctaagtgaaggagacttattggcagagatagagactgacaaagcc
actataggttttgaagtacaggaagaaggttatctggcaaaaatcctggtccctgaaggc
acaagagatgtccctctaggaaccccactctgtatcattgtagaaaaagaggcagatata
tcagcatttgctgactataggccaaccgaagtaacagatttaaaaccacaagcaccacca
cctaccccacccccggtggctgctgttcctccaactccccagcctttagctcctacacct
tcagcaccctgcccagctactcctgctggaccaaagggaagggtgtttgttagccctctt
gcaaagaagttggcagtagagaaagggattgatcttacacaagtaaaagggacaggacca
gatggtagaatcaccaagaaggatatcgactcttttgtgcctagtaaagttgctcctgct
ccagcagctgttgtgcctcccacaggtcctggaatggcaccagttcctgcaggtgtcttc
acagatatcccaatcagcaacattcgtcgggttattgcacagcgattaatgcaatcaaag
caaaccatacctcattattacctttctatcgatgtaaatatgggagaagttttgttggta
cggaaagaacttaataagattttagaagggagaagcaaaatttctgtcaatgacttcatc
ataaaagcttcagctttggcatgtttaaaagttcccgaagcaaattcttcttggatggac
acagttataagacaaaatcatgttgttgatgtcagtgttgcagtcagtactcccgcagga
ctcatcacacctattgtgtttaatgcacatataaaaggactggaaaccattgctaatgat
gttgtttctttagcaaccaaagcaagagagggtaaactacagccacatgaattccagggt
ggcacttttacgatctccaatttaggaatgtttggaattaagaatttctctgctattatt
aacccacctcaagcatgtattttggcaattggtgcttcagaggataaactggtccctgca
gataatgaaaaagggtttgatgtggctagcatgatgtctgttacactcagttgtgatcac
cgggtggtggatggagcagttggagcccagtggcttgctgagtttagaaagtaccttgaa
aaacctatcactatgttgttgtaa

DBGET integrated database retrieval system