KEGG   Pongo abelii (Sumatran orangutan): 100432205Help
Entry
100432205         CDS       T01416                                 

Gene name
USP14
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 14 isoform X1
  KO
K11843  ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100432205 (USP14)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100432205 (USP14)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100432205 (USP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 ubiquitin
Motif
Other DBs
NCBI-GeneID: 100432205
NCBI-ProteinID: XP_024091573
Position
18
AA seq 493 aa AA seqDB search
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATV
QCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKK
SLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK
QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCT
PELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEIKYEPFSFADDIGSNNCGYYDL
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLY
GPRRVEIMEEESE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctactccgttactgtaaaatggggaaaggagaaatttgaaggtgtagaattg
aatacagatgaacctccaatggtattcaaggctcagctgtttgcgttgactggagtccag
cctgccagacagaaagttatggtgaaaggaggaacgctaaaggatgatgattggggaaac
atcaaaataaaaaatggaatgactctactaatgatggggtcagcagatgctcttccagaa
gaaccctcagccaaaactgtcttcgtagaagacatgacagaagaacagttagcatctgct
atggagttaccatgtggattgacaaaccttggtaacacttgttacatgaatgccacggtt
cagtgtattcgttctgtgcctgaactcaaagatgcccttaaaaggtatgcaggtgccttg
agagcttcaggggaaatggcttcagcgcagtatattactgcagcccttagagatttgttt
gattccatggataaaacttcttccagtattccacctattattctactgcagtttttgcac
atggctttcccacagtttgccgagaagggtgaacaaggacagtatcttcaacaggatgct
aatgaatgttggatacaaatgatgcgagtattgcaacagaaattggaagccatagaggat
gattctgttaaagagacagactcttcatctgcatcggcagcgacaccttctaaaaagaaa
agtttaattgatcagttcttcggtgttgagtttgaaactaccatgaaatgtacagaatct
gaagaagaggaagtcaccaaaggaaaggaaaaccaacttcagcttagctgttttatcaat
caggaagtcaagtatctttttacaggacttaaattgcgacttcaggaagaaatcaccaaa
cagtctccaacgttgcaaagaaatgccttgtatatcaaatcttccaagatcagccggcta
cctgcttacttgaccattcagatggttcgatttttttataaagagaaggaatctgtgaat
gccaaagttcttaaggatgttaaatttcctcttatgttggatatgtatgaactgtgtaca
ccagaacttcaggagaaaatggtgtcttttcgatccaaattcaaggatctagaagataaa
aaagtgaatcagcagccaaatacaagtgacaaaaagagtagtccccagaaagaaattaag
tatgaacccttttcttttgctgatgatattggctccaataattgtggatactatgactta
caagcagtactaacacaccagggaaggtctagttcttcaggtcattatgtatcgtgggtg
aaaaggaaacaagatgaatggattaagtttgatgatgacaaagtcagcatcgtaacacca
gaagatatcttacggctttctggtggtggagactggcatatcgcttacgttctactctat
gggcctcgcagagttgaaataatggaagaggagagtgaatag

DBGET integrated database retrieval system