KEGG   Pongo abelii (Sumatran orangutan): 100432205Help
Entry
100432205         CDS       T01416                                 

Gene name
USP14
Definition
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
pon  Pongo abelii (Sumatran orangutan)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 510 aa AA seqDB search
MVPPPHSAPICLKFRSADLQRGWKKLVVPKGPKLGLQDSLVIYMMNKLQIVFAVTVKWGK
EKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNMELPCGL
TNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTS
SSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETD
SSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLF
TGLKLRLQEEITKQSPTLQRNALYIKSVTWLPAYLTIQMVRFFIKRKESVNAQSFLRDVK
FPLMLHMYELCTPELQEKIVSFRSKFKDLEDKKVNQQPNTVVTKKSSPQKEIKYEPFSFA
DDIGSNNCGYYDLTSPVLNTPGEGSRFFRSFMYRWVKRKQDEWIKFDDDKVSIVTPEDIL
RLSGGGDWHIAYVLLYGKPRRVEIMEEESE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggttccacctcctcactctgcccccatttgtcttaaatttaggtctgcggatcttcag
agaggctggaagaagctagttgtaccaaagggaccaaaacttggtctacaagattccctg
gtcatctacatgatgaataaacttcaaatagtgtttgcagttactgtaaaatggggaaag
gagaaatttgaaggtgtagaattgaatacagatgaacctccaatggtattcaaggctcag
ctgtttgcgttgactggagtccagcctgccagacagaaagttatggtgaaaggaggaacg
ctaaaggatgatgattggggaaacatcaaaataaaaaatatggagttaccatgtggattg
acaaaccttggtaacacttgttacatgaatgccacggttcagtgtattcgttctgtgcct
gaactcaaagatgcccttaaaaggtatgcaggtgccttgagagcttcaggggaaatggct
tcagcgcagtatattactgcagcccttagagatttgtttgattccatggataaaacttct
tccagtattccacctattattctactgcagtttttgcacatggctttcccacagtttgcc
gagaagggtgaacaaggacagtatcttcaacaggatgctaatgaatgttggatacaaatg
atgcgagtattgcaacagaaattggaagccatagaggatgattctgttaaagagacagac
tcttcatctgcatcggcagcgacaccttctaaaaagaaaagtttaattgatcagttcttc
ggtgttgagtttgaaactaccatgaaatgtacagaatctgaagaagaggaagtcaccaaa
ggaaaggaaaaccaacttcagcttagctgttttatcaatcaggaagtcaagtatcttttt
acaggacttaaattgcgacttcaggaagaaatcaccaaacagtctccaacgttgcaaaga
aatgccttgtatatcaaatctgtaacctggctacctgcttacttgaccattcagatggtt
cgattttttataaagagaaaggaatctgtgaatgcccaaagtttcttaagggatgttaaa
tttcctcttatgttgcatatgtatgaactgtgtacaccagaacttcaggagaaaatagtg
tcttttcgatccaaattcaaggatctagaagataaaaaagtgaatcagcagccaaataca
gtagtgacaaaaaagagtagtccccagaaagaaattaagtatgaacccttttcttttgct
gacgatattggctccaataattgtggatactatgacttaacaagtccagtactaaacaca
ccaggggaaggttctaggttcttcaggtcatttatgtatcgttgggtgaaaaggaaacaa
gatgaatggattaagtttgatgatgacaaagtcagcatcgtaacaccagaagatatctta
cggctttctggtggtggagactggcatatcgcttacgttctactctatgggaaacctcgc
agagttgaaataatggaagaggaaagtgaatag

DBGET integrated database retrieval system