KEGG   Pongo abelii (Sumatran orangutan): 100432433Help
Entry
100432433         CDS       T01416                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100432433 (ART4)
Cellular antigens [BR:pon04090]
 Proteins
  100432433 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 309 aa AA seqDB search
MKLQGQRRSICDTSKWGPLINRCKKILLPTTAPPATMRIWLLGGLLPFLLLLSGLQRPTE
GSEVAIKIDFDFAPGSFDDQYQGCSKQVMEKLTQGDYFTKDIEAQTNYFRMWQKAHLTWL
NQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAMAYVARTPQQYERSFHFKYLHYYLTS
AIQLLRKDSIMKNGTLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTL
FTIFTCLGAPVQYFSLKXEVLIPPYELFKVINMSYHPRGNWLQLTXTGNLSTYNCQLLKL
PARNASLIL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcaagggcaaaggagaagtatttgtgacacaagcaaatggggtccattgatc
aacagatgcaagaagattcttctcccaactactgcacctcctgcaacgatgagaatctgg
ctccttggaggcctgctgccatttctgctgctcctctctggcctgcagagacccacagag
ggttctgaggttgcaattaaaatcgactttgacttcgcaccaggttcttttgatgatcag
taccaaggctgtagcaaacaggttatggagaaactaactcaaggggattatttcacaaaa
gacatagaagcccagacgaattactttaggatgtggcaaaaagcccacttaacctggctt
aaccaaggaaaagttctaccccagaacatgactaccacacacgctgtggctattttgttt
tatacattgaacagcaatgttcattctgactttactagagccatggcctatgttgccagg
actccacagcagtatgaacgttcattccacttcaaatatttacactactacctcacctca
gcaatccagctgctgaggaaagacagtatcatgaagaatggcactctgtgctatgaggtg
cattataggacgaaggatgtccacttcaacgcctacacaggggccaccattcgatttggc
caattcctctccacatccctcctaaaagaagaggcacaggagtttggaaaccagacacta
tttaccatattcacctgcctgggtgcacctgtacaatacttctccctcaagnaagaagtc
ttgatccctccctatgagctgtttaaagttataaatatgagctaccacccaagaggaaac
tggttgcagttgacgntcactgggaacctgagcacgtataactgtcagctgctaaaactt
ccagcaagaaatgcatccctgatcctatag

DBGET integrated database retrieval system