KEGG   Pongo abelii (Sumatran orangutan): 100432513Help
Entry
100432513         CDS       T01416                                 

Gene name
ACHE
Definition
acetylcholinesterase
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pon00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:pon04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 534 aa AA seqDB search
MGKIKDIPAVTAVEGVLSSPGVSHVTFSAPVPPGPLRGPSSATLPNASPPMPPVCVVAGD
AWPLGLALTSPASSETDRVSKCVRPSVKVGPCVCLCLSLHEVVRLRVSISTGFCPSVCHV
GVYSAAAGLWVASVTARLSSVGVWHWILXXXXSSSRRGPARPGSAAAADAACPAAMRPPQ
CLLHAPSLASPLLLILWFLGGGVGAEGREDAELLVSVRGGRLRGIRLKTPGGPVSAFLGI
PFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSED
CLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGA
FGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLS
PPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTELVACLRT
RPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVTSG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatcaaggacatccctgcagtaacagctgtggagggtgtcctttcatcccca
ggagtgtcccacgtcaccttttctgcaccagtgccacctggacccctaaggggaccgtcc
tcggccacactcccaaatgcctctcctcccatgccacccgtctgtgtcgtggccggggat
gcatggccccttggccttgcgctaacttcaccagcctcgagcgagaccgacagggtgtcc
aagtgtgtccgtccgtctgtgaaagtcggtccctgcgtttgtctgtgcctgtcactgcat
gaggtcgtccgtctgcgcgtgtctatctccacgggcttctgtccgtctgtctgtcacgtg
ggtgtctattccgccgctgcaggtctttgggtcgcgtctgtcactgcgcgtctgtcgtcg
gtcggcgtctggcactggattttannnnnnnnnncctccagctcccggcgcggcccggcc
cggcccggctcggccgccgcagcagacgccgcctgccctgcagccatgaggcccccgcag
tgtctgctgcacgcgccttccctggcttccccactcctcctcatcctctggttcctggga
ggaggagtgggggctgagggccgggaggatgcagagctgctggtgtcggtgcgtgggggc
cggctgcggggcattcgcctgaagacacctgggggccccgtctctgctttcctgggcatc
ccctttgcggagccacccatgggaccccgtcgctttctgccaccggagcccaagcagcct
tggtcaggggtggtagacgctacaaccttccagagtgtctgctaccaatatgtggacacc
ctatacccaggttttgagggcaccgagatgtggaaccccaaccgtgagctgagcgaggac
tgcctgtacctcaacgtgtggacaccatacccccggcctacatcccccacccctgtcctc
gtctggatctatgggggtggcttctacagtggggcctcctccttggacgtgtacgatggc
cgcttcttggtacaggccgagaggactgtgctggtgtccatgaactaccgggtgggagcc
tttggcttcctggccctgccggggagccgagaggccccgggcaatgtgggtctcctggat
cagaggctggccctgcagtgggtgcaggagaacgtggcagccttcgggggtgacccgaca
tcagtgacgctgtttggggaaagcgcgggagccgcctcggtgggcatgcacctgctgtcc
ccgcccagccggggcctgttccatagggccgtgctgcagagcggtgcccccaatggaccc
tgggccacggtgggcatgggagaagcccgtcgcagggccacgcagctggcccaccttgtg
ggctgtcctccaggcggcactggtgggaatgacacagagctggtagcctgccttcggaca
cgaccagcgcaggtcctggtgaaccacgaatggcacgtgctgcctcaagaaagcgtcttc
cggttctccttcgtgcctgtggtagatggagacttcctcagtgacaccccagaggccctc
atcaacgcgggagacttccacggcctgcaggtaactagtggctag

DBGET integrated database retrieval system