KEGG   Pongo abelii (Sumatran orangutan): 100432710Help
Entry
100432710         CDS       T01416                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100432710 (NCOA1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100432710 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2A
AA seq 1287 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEAGQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSTCNNNNRSYSNIPVTS
LQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC
TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN
QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGT
MPVQVTPPRGAFSAGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AATAPVGINMRSGMQQQITPQVMXENQTSLSVIWHRQRQLIQQQRAMLMRQQSFGNNLPP
SSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLASRNSMVS
RGMTGNMGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSS
LLQQTPPASGYQSPDMKAWQQGAIGNN
NT seq 3863 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacattagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtggatcagatacagttaatg
aagagaatggaacaagagaaatcaacaactgatgatgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgta
accagctacttaggttacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccagggaccgagaaccaagaagctggccagcgttatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtctgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttctctg
agagctgctggcagaactggttgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacagctgttccaagaagtgatgactcgt
ggcactgcctccagcccctcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctcagtcaatcctagtatctctccagctcatggtgta
gctcgttcatccacattgccaccatccaacagcaacatggtatccaccagaataaaccgc
cagcagagctcagaccttcatagcagcagtcatagtaattctagcaacagccaaggaagt
ttcggatgctcacctggaagtcagattgtagccaatgttgccttaaaccaaggacaggcc
agttcacagagcagtaatccctctttaaacctcaataattctcctatggaaggtacagga
atatccctagcacagttcatgtctccaaggagacaggttacttctggattggcaacaagg
cccaggatgccaaacaattcctttcctcctaatatttcgacattaagctctcccgttggc
atgacaagtagtacctgtaataataataaccgatcttattcaaacatcccagtaacatct
ttacagggtatgaatgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcatcaattttaaatgaaatgattcaatctgacaac
agctctagtgatggcaaacctctggattcagggcttctgcataacaatgacagactttca
gatggagacagtaaatactctcaaaccagtcacaaactagtgcagcttttgacaacaact
gccgaacagcagttacggcatgctgatatagacacaagctgcaaagatgtcctgtcttgc
acaggcacttccaactctgcctctgctaactcttcaggaggttcttgtccctcctctcat
agctcattgacagagcggcataaaattctacatcggctcttacaggagggtagcccctca
gatatcaccactttgtctgtcgagcctgataaaaaggacagtgcatctacttctgtgtca
gtgactggacaggtacaaggaaactccagtataaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgctatcttttagataaagatgagaaagattta
agatcaactccaaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaacag
atggatccttgtaatacaaacccaaccccaatgaccaaacccactcctgaggaaataaaa
ctggaggcccagagccagtttacagctgaccttgaccagtttgatcagttactgcccacg
ctggagaaagcagcacagttgccaggcttatgtgagacagacaggatggatggtgcggtc
accagtgtaaccatcaaatcggagatcctgccagcttcacttcagtccgccactgccaga
cccacttccaggctaaatagattacctgagctggaattggaagcaattgataaccaattt
ggacaaccaggaacaggcgatcagattccatggacaaataatacagtgacagctataaat
cagagtaaatcagaagaccagtgtattagctcacaattagatgagcttctctgtccaccc
acaacagtagaagggagaaatgatgagaaggctcttcttgaacagctggtatccttcctt
agtggcaaagatgaaactgagctagctgaactagacagagctctgggaattgacaaactt
gttcaggggggtggattagatgtattatcagagagatttccaccacaacaagcaacgcca
cctttgatgatggaagaaagacccaacctttattcccagccttactcatctccttctcct
actgccaatctccctagccctttccaaggcatggtcaggcaaaaaccttcactggggacg
atgcctgttcaagtaacacctccccgaggtgctttttcagctggcatgggcatgcagccc
aggcaaactctaaacagacctccggctgcacctaaccagcttcgacttcaactacaacag
cgattacagggacaacagcagttgatacaccaaaatcggcaagctatcttaaaccaattt
gcagcaactgctcctgttggcatcaatatgagatcaggcatgcaacagcaaattacacct
caggtaatgtgagaaaaccagacgtcattatcagtcatatggcaccgacagaggcagcta
atacagcagcaaagagccatgcttatgaggcaacaaagctttgggaacaacctccctccc
tcatctggactaccagttcaaatggggaacccccgtcttcctcagggtgctccacagcaa
ttcccctatccaccaaactatggtacaaatccaggaaccccacctgcttcaaccagccca
ttttcacaactagcagcaaatcctgaagcatccttggccagccgcaacagcatggtgagc
agaggcatgacaggaaacatgggaggacagtttggcactggaatcaatcctcagatgcag
cagaatgtcttccagtatccaggagcaggaatggttccccaaggtgaggccaactttgct
ccatctctaagccctgggagctccatggtgccgatgccaatccctcctcctcagagttct
ctgctccagcaaactccacctgcctccgggtatcagtcaccagacatgaaggcctggcag
caaggagcgataggaaacaacaa

DBGET integrated database retrieval system