KEGG   Pongo abelii (Sumatran orangutan): 100432728Help
Entry
100432728         CDS       T01416                                 

Gene name
TACC3
Definition
transforming, acidic coiled-coil containing protein 3
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100432728 (TACC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 830 aa AA seqDB search
MSLQVLNDKNVSSEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTP
LRDPQTHRILSPSMASKLEAPFTQDDALGLENSHPVWTQKENQQLIKEVDAKSTHGMVQK
PVETDTDLLGDASPAFGSGSSSEPGAGTLADLDCSSSSQSPGSSENQMVSPGKVSGSPEQ
AVEENVSSYSLDERMTPTSETLEDLSRTESQHKAETPHGAEEECRHGGVCAPTVVATSPP
GAIPEEACGGAPLQGLPGEALACPAGMGTPVPADGTQTLTCAHTSAPESTAPTSHLVADR
AMTLSPQEEVAAGQMASSSRSRPIKLEFDLSDGPTSKRAPPPRRLGERSGLKPPLRRAAA
RQQKAPREVEEDGRSGAGEDPPMPASWGSYHLDWDKMDDPNFSLFGGDTKSGCREAQPPE
SPETSLGQPVAEQLTAGPATEEPGPCLSQQLHSASAEDTPVVQLAAETPRAESKERALNS
ASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTSAEVDYLEQFGTSSVGTGH
FRESALRKQSLYVKFDPXLRDSPCRPVPXGNETSSMHGANETPSGRQREAKLVEFDFLGA
LDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVKATQEENRELRSRCEELHGK
NLELGKIMDRFEEVVYQAMEEVQKQKELAKAEIQKVLKEKDQLTTDLNSMEKSFSDLFKR
FEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQLANEEIAQVRSK
AQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcaggtcttaaacgacaaaaatgtcagcagtgaaaaaaatacagaaaattgc
gacttcctgttttcgccaccagaagttaccggaagatcgtctgttcttcgtgtgtcacag
aaagaaaatgtgccacccaagaacctggccaaagctatgaaggtgacttttcagacacct
ctgcgggatccacagacgcacaggattctaagtcctagcatggccagcaaacttgaggct
cctttcactcaggatgacgcccttggactggaaaactctcacccggtctggacacagaaa
gagaaccaacagctcatcaaggaagtggatgccaaaagtactcatggaatggtacagaaa
ccagtggagactgacaccgacctcctgggggatgcaagcccagcctttgggagtggcagc
tccagcgagcctggcgcgggtaccctggctgacctggactgctcaagctcttcccagagc
ccaggaagttctgagaaccaaatggtgtctccaggaaaagtgtctggcagccctgagcaa
gctgtggaggaaaacgttagttcctattccttagacgaaagaatgacacccacctctgag
accctagaagacctttccaggacagagtcccagcacaaagcggagactccacacggggcc
gaggaagaatgccggcacggtggggtctgtgctcccacagtagtggccacttcgcctcct
ggtgcaatccctgaggaagcctgcggaggagcacccctgcagggtctgcctggcgaggcc
ctggcctgccctgcgggtatgggcaccccggtgccagcagatggcactcagacccttacc
tgtgcacacacctctgctcctgagagcacagccccgaccagccacctggtggctgacagg
gccatgaccctgagtcctcaggaagaagtggctgcgggccaaatggccagctcctcgagg
agcagacctataaaactagaatttgatttatctgatggccccaccagcaaaagggcaccc
ccaccaaggagattgggagagagatccggcctcaagcctcccttgaggagagcagcagcg
aggcagcaaaaggccccgcgggaggtggaggaggacggtaggagcggagcaggagaggat
ccccccatgccggcttcttggggctcttaccacctcgactgggacaaaatggatgaccca
aacttcagcctgttcggaggtgacaccaagtctggttgcagagaggcccagcccccagaa
agccctgagaccagtctgggccagccagtggctgaacagctgactgctgggcctgccacg
gaggagccaggcccctgtctgagccagcagctgcattcagcctcagcggaggacacacct
gtggtgcagttggcagccgagaccccaagagcagagagcaaggagagagccttgaactct
gccagcacctcgcttcccacaagctgtccaggcagtgagccagtgcccacccatcagcag
gggcagcctgccttggagctgaaagaggagagcttcagagaccccgctgaggttctaggc
acgagcgcggaggtggattacctggagcagtttggaacttcctcggtaggtaccgggcac
ttccgcgaatcggccttgaggaagcagtccttatacgtcaagttcgaccccntcctgagg
gacagtccttgtagaccagtgcccnngggcaatgagaccagcagcatgcacggtgcaaat
gagactccctcaggacgtcagcgggaagccaagcttgtggagttcgatttcttgggagca
ctggacattcctgtgccaggcccacccccaggtgtccccgcgcctgggggcccacccctg
tccaccggacctatagtggacctgctccagtacagccagaaggacctggatgcagtggta
aaggcaacacaggaggagaaccgggagctgaggagcaggtgtgaggagctccatgggaag
aacctggagctggggaagatcatggacaggttcgaagaggttgtgtaccaggccatggag
gaagttcagaaacagaaggaacttgccaaagctgaaatccagaaagttctaaaagaaaaa
gaccaacttactacagatctgaactccatggagaagtccttctccgacctcttcaagcgt
ttcgagaaacagaaggaagtgatcgagggctaccgcaagaacgaagagtcactgaagaag
tgtgtggaggattacctcgcaaggatcacccaggaaggccagaggtaccaagccctgaag
gcccatgcggaggagaagctgcagctggcaaacgaggagatcgcccaggtccggagcaag
gcccaggcagaagcgttggccctccaggccagcctgaggaaggagcagatgcggatccag
tcgctggagaagacagtggagcagaagactaaagagaacgaggagctgaccaggatctgc
gacgacctcatctccaagatggagaagatctga

DBGET integrated database retrieval system