KEGG   Pongo abelii (Sumatran orangutan): 100432952Help
Entry
100432952         CDS       T01416                                 

Definition
uncharacterized LOC100432952
Orthology
K05759  
profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:pon04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:pon04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:pon05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 260 aa AA seqDB search
MLSRPRSRRRRGQTRRRPPVLPFGGGSGGARAAAQRAEPRSGRQRVPRALRLPPPASRGS
ASPVRGPSSSAESSPSSSAMAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFV
NITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNV
TVTKTDKSEFLSLTLPLAPRSLTYRLLVILRVFFCVIPQHEGSQTSIVFLVCWMLEHGIV
PPFCLSSSSCNSKLLNCITS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccggccccggagcaggcgcaggcgcgggcagacgcgccgccgcccgccggtc
cttcccttcggcggaggaagtggcggtgcgagggctgctgcacagcgagcagagccgcgg
tccggacggcagcgcgtgccccgagctctccgcctccccccgcccgccagccgaggcagc
gcgagcccagtccgcggccccagcagcagcgccgagagcagccccagtagcagcgccatg
gccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcggcc
atcgtgggctacaaggactcgccctccgtctgggccgcggtccccggcaaaaccttcgtc
aacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttacgtg
aatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcaggat
ggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaatgtc
actgtcaccaagactgacaagagtgagttcctgagtcttacccttcctttagctccaaga
tctctaacgtaccgccttctggtaatcttgagggtgtttttttgtgtgattccccaacat
gaagggagtcagaccagtattgtgttccttgtctgctggatgctggaacacgggatagtc
cctccattctgtctcagttcctcatcttgtaattcaaagttgctgaactgcattacctct
taa

DBGET integrated database retrieval system