KEGG   Pongo abelii (Sumatran orangutan): 100432952Help
Entry
100432952         CDS       T01416                                 

Gene name
PFN1
Definition
(RefSeq) profilin 1
  KO
K05759  
profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100432952 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100432952 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100432952 (PFN1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100432952 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 181 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKSEFLSLTLPLAP
RSLTYRLLVILRVFFCVIPQHEGSQTSIVFLVCWMLEHGIVPPFCLSSSSCNSKLLNCIT
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctacaaggactcgccctccgtctgggccgcggtccccggcaaaaccttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagagtgagttcctgagtcttacccttcctttagctcca
agatctctaacgtaccgccttctggtaatcttgagggtgtttttttgtgtgattccccaa
catgaagggagtcagaccagtattgtgttccttgtctgctggatgctggaacacgggata
gtccctccattctgtctcagttcctcatcttgtaattcaaagttgctgaactgcattacc
tcttaa

DBGET integrated database retrieval system