KEGG   Pongo abelii (Sumatran orangutan): 100432996Help
Entry
100432996         CDS       T01416                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100432996
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100432996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 409 aa AA seqDB search
MNRSLLVGCVQKKDIWGREESIYKRLKQDGLDVERAESWELGHVVLSPVWFLYSLLMKLF
QRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDG
NLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPNG
LLVYQGKGKFAIRPDKKSNPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLL
FANQTEKDILLRPELEELRNEHSTRFKLWYTLDRAPEGAAEYTKAIFSPIVSPGEWAGPT
LGLPLFHLSMAELLAKGGTKAIFSPIVSPGEWAGPTLGLPLFHLSMAELPAKGVVGEPRW
RQREMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDRVGHPKERCFAF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaataggagtttgctggttggatgcgtgcagaagaaggacatttggggcagagaggag
agcatatacaaacgcctgaagcaagatggtcttgatgttgaaagagcagaaagctgggag
ttgggccatgtggtgctctccccagtctggttcctgtacagtctgctcatgaagctgttc
cagcgctccacgccagccatcaccctcgagagcccggacatcaagtacccgctgcggctc
atcgaccgggagatcatcagccatgacacccggcgcttccgctttgccctgccgtcaccc
cagcacatcctgggcctccccgtcggccagcacatctacctctcggctcgaattgatgga
aacctggtcatccggccctatacacccgtctccagcgatgatgacaagggcttcgtggac
ctggtcatcaaggtttacttcaaggacacccatcccaagtttcccgccggagggaagatg
tctcagtacctggagagcatgcagattggagacaccattgagttccggggccccaacggg
ctgctggtctaccagggcaaagggaagttcgccatccgacctgacaaaaagtccaaccct
gtcatcaagacagtgaagtctgtgggcatgatcgcgggagggacaggcatcaccccgatg
ctgcaggtgatccgtgccatcatgaaggaccctgatgaccacactgtgtgccacctgctc
tttgccaaccagactgagaaggacatcctgctgcgacctgagctggaggaactcaggaac
gaacattctacgcgcttcaagctctggtacacgctggacagagcccctgaaggtgctgcc
gagtacaccaaggccatcttctctcccattgtcagccctggggagtgggctgggccgacg
ttggggttacccttgttccacctgtccatggctgagctgcttgccaagggaggcaccaag
gccatcttctctcccattgtcagccctggggagtgggctgggccgacgttggggttaccc
ttgttccacctgtccatggctgagctgcctgccaagggagttgtgggagagccacgctgg
aggcagcgagagatgatccgggaccaccttccgcccccagaggaggagccgttagtgctg
atgtgtggccccccacccatgatccagtatgcctgccttcccaacctggaccgcgtgggc
caccccaaggagcgctgcttcgccttctga

DBGET integrated database retrieval system