KEGG   Pongo abelii (Sumatran orangutan): 100433198Help
Entry
100433198         CDS       T01416                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:pon04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:pon04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 347 aa AA seqDB search
MERKFMSLHPSISISEMEPNGTFSNNNNSRNCTIKNFKTEFFPIVYLIIFVWGVLGNGLS
IYVFLQPYKKSTSVNIFMLNLAISDLLFISTLPFRAYYYLRGSNWIFGDLACRIMSYSFY
VNMYSSIYFLTVLSVVRFLATVHPFRLLHVTSIRTAWILCGIIWILIMASSIMLLDSGSE
QKGSVTSCLELNLYKIAKLQTMNYIALVVGFLLPFFTLSICYLLIIRVLLKVEVPESGLQ
VSHKKALTTIIITLIIFFLCFLPYHTLRTLHLATWKVGICKDRLHKAVVITLALAAANTC
FNPLLYYFAGENFKDRLRSALRKGHPQKAKTKCAFPVSVWLRKETRV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaatttatgtccttgcatccatccatctccatatcagaaatggaaccaaat
ggcaccttcagcaataacaacaatagcaggaactgcacaatcaaaaacttcaagacagaa
tttttcccaattgtatatctgataatatttgtctggggagtattgggaaatggtttgtcc
atatatgttttcctgcagccttataagaagtccacatctgtgaacattttcatgctaaat
ctggccatttcagatctcctgttcataagcacgcttcccttcagggcttactattacctt
agaggctccaattggatatttggagacctggcctgcaggattatgtcttattctttctat
gtcaacatgtacagcagtatttatttcctgaccgtgctgagtgttgtgcgtttcctggca
acggttcacccctttcggcttctgcatgtcaccagcatcaggactgcctggatcctctgt
gggatcatatggatccttatcatggcttcctcaataatgctcctggacagtggctctgag
cagaagggcagtgtcacatcatgcttagagctgaatctctataaaattgctaagctgcag
accatgaactatattgccttggtggtgggcttcctgctgccatttttcacactcagcatc
tgttatctgctgatcattcgggttctgttaaaagtggaggtcccagaatcggggctgcag
gtttctcacaagaaggcactgaccaccatcatcatcaccttgatcatcttcttcttgtgt
ttcctgccctatcacacactgaggaccctccacttggcgacatggaaagtgggtatatgc
aaagacaggctgcataaagctgtggttatcacactggccttggcggcagccaatacctgc
ttcaatcctctgctctattactttgctggggagaattttaaggacagactaaggtctgca
ctcagaaaaggccatccacagaaggcaaagacaaagtgtgctttccctgttagtgtgtgg
ttgagaaaggaaacaagagtataa

DBGET integrated database retrieval system