KEGG   Pongo abelii (Sumatran orangutan): 100433388Help
Entry
100433388         CDS       T01416                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:pon04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:pon04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:pon05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 137 aa AA seqDB search
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRRTFL
QAGLTVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNRKVHELIRGLRMQGA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggaaggtctacatcagtgcggtgctgcgggaccagcgcattgacgacgtg
gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg
gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcgcaccttcctg
caggcgggcctgaccgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc
gagggcgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg
ggccgtgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc
ctcaacaggaaggtgcacgaactgatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system