KEGG   Pongo abelii (Sumatran orangutan): 100433388Help
Entry
100433388         CDS       T01416                                 

Gene name
PFN3
Definition
(RefSeq) profilin-3
  KO
K05759  profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100433388 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100433388 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100433388 (PFN3)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Others
    100433388 (PFN3)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100433388 (PFN3)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100433388 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 100433388
NCBI-ProteinID: XP_002816318
Ensembl: ENSPPYG00000016090
UniProt: H2PHI2
Position
5
AA seq 137 aa AA seqDB search
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRRTFL
QAGLTVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNRKVHELIRGLRMQGA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggaaggtctacatcagtgcggtgctgcgggaccagcgcattgacgacgtg
gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg
gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcgcaccttcctg
caggcgggcctgaccgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc
gagggcgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg
ggccgtgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc
ctcaacaggaaggtgcacgaactgatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system