KEGG   Pongo abelii (Sumatran orangutan): 100433428Help
Entry
100433428         CDS       T01416                                 

Definition
retinoic acid receptor RXR-alpha-like
Orthology
K08524  
retinoid X receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100433428
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100433428
   03320 PPAR signaling pathway
    100433428
   04919 Thyroid hormone signaling pathway
    100433428
  Digestive system
   04976 Bile secretion
    100433428
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100433428
   05202 Transcriptional misregulation in cancers
    100433428
   05216 Thyroid cancer
    100433428
   05222 Small cell lung cancer
    100433428
   05223 Non-small cell lung cancer
    100433428
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100433428
  Infectious diseases
   05160 Hepatitis C
    100433428
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100433428
Nuclear receptors [BR:pon03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100433428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 318 aa AA seqDB search
MAASELSALPQTPSLLLDPEGLWQGLRDLGQWRCQYPSAQMLAEICVCGGFLPRGLRSVA
VQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDP
VTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSNRSIAVKDGI
LLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLS
NPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGD
TPIDTFLMEMLEAPHQMT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcggagctgtctgcccttccccagaccccctccctcctgctcgaccctgag
ggactgtggcagggtctcagggacctgggccagtggaggtgccagtacccctcagctcag
atgctggctgagatctgcgtgtgcgggggcttcctgccccgggggctgcgcagcgtggcc
gtgcaggaggagcggcagcgtggcaaggaccggaacgagaatgaggtggagtcgaccagc
agcgccaatgaggacatgccggtggagaggatcctggaggctgagctggccgtggagccc
aagaccgagacctacgtggaggcaaacatgggtctaaaccccagctcgccaaacgacccc
gtcaccaacatttgccaagcagctgacaagcagctcttcaccctggtggagtgggccaag
cggatcccacacttctcagagctgcccctggacgaccaggtcatcctgctgcgggcaggc
tggaatgagctgctcatcgcctctttctccaaccgctccatcgccgtgaaggacgggatc
ctcctggccaccgggctgcacgtccaccggaacagcgcccacagcgcaggggtgggcgcc
atctttgacagggtgctgacggagctcgtgtccaagatgcgggacatgcagatggacaag
acggagctgggctgcctgcgtgccatcgtcctcttcaaccctgactccaaggggctctcg
aacccggctgaggtggaggcgctgagggagaaggtctacgcatccctggaggcctactgc
aagcacaagtacccagagcagccgggaaggttcgccaagctcttgctccgcctgccggct
ctgcgctccatcgggctcaagtgcctggaacatctcttcttcttcaagctcatcggggac
acgcccattgacaccttcctcatggagatgctggaggcgccgcaccaaatgacttag

DBGET integrated database retrieval system