KEGG   Pongo abelii (Sumatran orangutan): 100433809Help
Entry
100433809         CDS       T01416                                 

Gene name
GRIK4
Definition
(RefSeq) glutamate receptor ionotropic, kainate 4 isoform X1
  KO
K05204  glutamate receptor, ionotropic kainate 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04080  Neuroactive ligand-receptor interaction
pon04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100433809 (GRIK4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100433809 (GRIK4)
Ion channels [BR:pon04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100433809 (GRIK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3
Motif
Other DBs
NCBI-GeneID: 100433809
NCBI-ProteinID: XP_024111674
Ensembl: ENSPPYG00000003977
Position
11
AA seq 956 aa AA seqDB search
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMASAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVLTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSIHPRRRRAGVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtctcggcgcctttggtgctgcttcctgcgtggctcgtgatggtcgcctgc
agcccgcactccttgaggatcgctgctatcttggacgaccccatggagtgcagcagaggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgcgctcctgagaggctgggc
aaggccaaggtcgaagtggacatctttgagcttctcagagacagcgagtatgagactgca
gaaaccatgtgtcagatcctccccaagggggtggtcgctgtcctcgggccatcgtccagc
ccagcctccagctccatcatcagcaacatctgtggagagaaggaggtgcctcacttcaaa
gtggccccagaggagttcgtcaagttccagttccagagattcacaaccctgaacctccac
cccagcaacaccgacatcagcgtggctgtagctgggatcctgaacttcttcaactgcact
accgcctgcctcatctgtgccaaagcagaatgccttttaaacctagagaagctgctccgg
caatttcttatctccaaggacacgctgtccgtccgcatgctggatgacacccgggacccc
accccgctcctcaaggagatccgggacgacaagaccgccaccatcatcatccacgccaac
gcctccatgtcccacaccatcctcctgaaggcagccgaacttgggatggcgtcagcctat
tacacatacatcttcactaatctggagttctcactccagagaatggacagccttgtggat
gatcgtgtcaacatcctgggattttccattttcaaccaatcccatgctttcttccaagag
tttgcccagagcctcaaccagtcctggcaggagaactgtgaccatgtgcccttcactggg
cctgcgctctcctcggccctgctgtttgatgctgtctatgctgtgctgactgcggtgcag
gaactgaaccggagccaagagatcggcgtgaagcccctgtcctgcggctcggcccagatc
tggcagcacggcaccagtctcatgaactacctgcgcatggtagaattggaaggtcttacc
ggccacattgaattcaacagcaaaggccagaggtccaactatgccttgaaaatcttacag
ttcacaaggaatggttttcggcagatcggccagtggcacgtggcagagggcctcagcatg
gacagccacctctatgcatccaacatctcagacactctcttcaacaccaccctggtcgtc
accaccatcctggaaaacccatatttaatgctgaaggggaaccaccaggagatggaaggc
aatgaccgctacgagggcttctgtgtggacatgctcaaggagctggcagagatcctccga
ttcaactacaagatccgcctggttggggatggcgtgtacggcgttcccgaggccaacggc
acctggacgggaatggtcggggagctgatcgctaggaaagcagatctggctgtggcaggc
ctcaccattacagctgaacgggagaaggtgattgatttctctaagccattcatgactctg
ggaattagcattctttaccgcgttcatatgggacgcaaacccggctatttctccttcctg
gacccattttctccgggcgtctggctcttcatgcttctagcctatctggccgtcagctgt
gtcctcttcctggtggcccggttgacgccctacgagtggtacagcccacacccatgtgcc
cagggccggtgcaacctcctggtgaaccagtactccctgggcaacagcctctggtttccg
gtcggggggttcatgcagcagggctccaccatcgcccctcgcgccttatccacccgctgt
gtcagtggcgtctggtgggcattcacgctgatcatcatctcatcctacacggccaacctg
gcagccttcctgaccgtgcagcgcatggatgtgcccattgagtcagtggatgacctggct
gaccagaccgccattgaatatggcacaattcacggaggctccagcatgaccttcttccaa
aattcccgctaccagacctaccaacgcatgtggaattacatgtattccaagcagcccagc
gtgttcgtgaagagcacagaggagggaatcgccagggtgttgaattccaactacgccttc
ctcctggaatccaccatgaacgagtactatcggcagcgaaactgcaacctcactcagatt
gggggcctgctggacaccaagggctatgggattggcatgccagtcggctcggttttccgg
gacgagtttgatctggccattctccagctgcaggagaacaaccgcctggagatcttgaag
cgcaaatggtgggaaggagggaagtgccccaaggaggaagatcacagagctaaaggcctg
ggaatggagaatattggtggaatctttgtggttcttatttgtggcttaatcgtggccatt
tttatggctatgttggagtttttatggactctcagacactcagaagcaactgaggtgtcc
gtctgccaggagatggtgaccgagctgcgcagcatcatcctgtgtcaggacagtatccac
ccccgccggcggcgcgccggagtcccgccgccccggccccccatccccgaggagcgccga
ccccgcggcacggcgacgctcagcaacgggaagctgtgcggggcaggggagcccgaccag
ctcgcgcagagactggcgcaggaggccgccctggtggcccgcggctgcacgcacatccgc
gtctgccccgagtgccgccgcttccagggcctgcgggcacggccgtcgcccgcccgcagc
gaggagagcctggagtgggagaaaaccaccaacagcagtgagcccgagtag

DBGET integrated database retrieval system