KEGG   Pongo abelii (Sumatran orangutan): 100434135Help
Entry
100434135         CDS       T01416                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100434135 (ARG1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100434135 (ARG1)
   00330 Arginine and proline metabolism
    100434135 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100434135 (ARG1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100434135 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 322 aa AA seqDB search
MSAKSRTIGIIGAPFSKGQPREGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLRELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPLLGKTPEEVTRTVNTAVAIT
LACFGVAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaagtccagaaccatagggattattggagctcctttctcaaagggacagcca
cgagaaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaactt
aaagaacaagagtgtgatgtgaaggattatggggacctgccctttgctgacatccctaat
gacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcaagcgagcagctg
gctggcaaggtggcagaagtcaagaagaacggaagaatcagcctggtgctgggcggagac
cacagtttggcaattggaagcatctctggccatgccagggtccaccctgatctcggagtc
atctgggtggatgctcacactgatatcaacactccactgacaaccacaagtggaaactta
catggacaacctgtatctttcctcctgagggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgactccctgcatatctgccaaggatattgtgtatattggcttgaga
gatgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactaggaattggcaaggtgatggaagaaacactcagctatctacta
ggaagaaagaaaaggccaattcatctgagttttgatgttgacggactggacccatctttc
acaccagctactggcacaccagtcgtgggaggtctgacatacagagaaggtctctacatc
acagaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaatcca
ttgctggggaagacaccagaagaagtaactcgaacagtgaacacagcagtagcaataacc
ttggcttgtttcggagttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system