KEGG   Pongo abelii (Sumatran orangutan): 100434135Help
Entry
100434135         CDS       T01416                                 

Gene name
ARG1
Definition
arginase, liver
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pon01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pon00330]
Human Diseases; Infectious diseases; Amoebiasis [PATH:pon05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 322 aa AA seqDB search
MSAKSRTIGIIGAPFSKGQPREGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPN
DSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV
IWVDAHTDINTPLTTTSGNLHGQPVSFLLRELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPLLGKTPEEVTRTVNTAVAIT
LACFGVAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaagtccagaaccatagggattattggagctcctttctcaaagggacagcca
cgagaaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaactt
aaagaacaagagtgtgatgtgaaggattatggggacctgccctttgctgacatccctaat
gacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcaagcgagcagctg
gctggcaaggtggcagaagtcaagaagaacggaagaatcagcctggtgctgggcggagac
cacagtttggcaattggaagcatctctggccatgccagggtccaccctgatctcggagtc
atctgggtggatgctcacactgatatcaacactccactgacaaccacaagtggaaactta
catggacaacctgtatctttcctcctgagggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgactccctgcatatctgccaaggatattgtgtatattggcttgaga
gatgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactaggaattggcaaggtgatggaagaaacactcagctatctacta
ggaagaaagaaaaggccaattcatctgagttttgatgttgacggactggacccatctttc
acaccagctactggcacaccagtcgtgggaggtctgacatacagagaaggtctctacatc
acagaagaaatctacaaaacagggctactctcaggattagatataatggaagtgaatcca
ttgctggggaagacaccagaagaagtaactcgaacagtgaacacagcagtagcaataacc
ttggcttgtttcggagttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system