KEGG   Pongo abelii (Sumatran orangutan): 100434248Help
Entry
100434248         CDS       T01416                                 

Gene name
CPB1
Definition
carboxypeptidase B1 (tissue)
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100434248 (CPB1)
   04974 Protein digestion and absorption
    100434248 (CPB1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     100434248 (CPB1)
Peptidases [BR:pon01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100434248 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 432 aa AA seqDB search
MLALLVLATVALASAHHGGEHFEGEKVFRIKVEDENHINIIRELASTTQNLSGAAEGHQE
EPEDNMRIYRECNVPSTKAVALGFYVCSLGKNTLMFTGTPTLVRCRVLISNLRNVVEAQF
DSRVRATGHSYEKYNNWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQN
KPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLNKLDFYVLPVLNIDGYIY
TWTKSRFWRKTRSTHAGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKA
LADFIRNNLSSIKAYLTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTK
YTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETLLAI
KYVASYVLKHLY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgctcttggttctggcgactgtggccctggcatctgctcatcatggtggtgag
cactttgaaggcgagaaggtgttccgtattaaagttgaagatgaaaatcacattaacata
atccgcgagttggccagcacgacccagaatctctctggagcagctgaaggtcatcaggaa
gaaccagaggacaacatgagaatttatagagagtgcaatgttccatctactaaagcagtg
gctctggggttttatgtgtgttcactggggaaaaatacacttatgttcacaggaacaccc
actttggttcgttgcagggtactgataagcaacctgagaaatgtggtggaggctcagttt
gatagccgggttcgtgcaacaggacacagttatgagaagtacaacaattgggaaacgata
gaggcttggactcaacaagtcgccactgagaatccagccctcatctctcgcagtgttatc
ggaaccacatttgaaggacgtgctatttacctcctaaaggttggcaaagctggacaaaat
aagcctgccattttcatggactgtggtttccatgccagagagtggatttctcctgcattc
tgccagtggtttgtaagagaggctgttcgtacctatggacgtgagatccaagtgacagag
cttctcaacaagttagacttttatgtcctgcctgtgctcaatattgatggctacatctac
acctggaccaagagccgattttggagaaagactcgctccacccatgctggatctagctgc
attggcacagaccccaacagaaattttgatgctggttggtgtgaaattggagcctctcga
aacccctgtgacgaaacttactgtggacctgctgcagagtctgaaaaggagaccaaggcc
ctggctgatttcatccgcaacaacctctcttccatcaaggcatatctgacaatccactca
tactcccaaatgatgatttacccttactcatatgcttacaaactcggtgagaacaatgct
gagttgaatgccctggctaaagctactgtgaaagaacttgcctcactgcacggcaccaag
tacacatatggcccgggagctacaacaatctatcctgctgctgggggctctgacgactgg
gcttatgaccaaggaatcagatattccttcacctttgaactccgagatacaggcagatat
ggcttcctccttccggaatcccagatccgggctacctgcgaggagaccttgctggcaatc
aagtatgttgccagctacgtcctgaaacacctgtactag

DBGET integrated database retrieval system