KEGG   Pongo abelii (Sumatran orangutan): 100434271Help
Entry
100434271         CDS       T01416                                 

Gene name
PPT2
Definition
palmitoyl-protein thioesterase 2
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100434271 (PPT2)
  Lipid metabolism
   00062 Fatty acid elongation
    100434271 (PPT2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100434271 (PPT2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100434271 (PPT2)
Lipid biosynthesis proteins [BR:pon01004]
 Fatty acid synthase
  Component type
   100434271 (PPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 308 aa AA seqDB search
MKSCGSMLGLWRQRLPAAWVLPLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRH
LLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGG
LVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFS
ICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPW
QSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTTWHSNRTLYE
TCIEPWLS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcgggagcatgctggggctctggaggcagcggctccccgcggcgtgggtc
ctgcccttgttgcctttcctgccgctgctgttgcttgcagcccccgcgccccaccgcgcg
tcctacaagccggtcatcgtggtgcatgggctcttcgacagctcgtacagcttccgccac
ctgctggaatacatcaatgagacacaccccgggactgtggtgacagtgctcgatctcttc
gatgggagagagagcttgcgacccctgtgggaacaggtgcaagggttccgagaggctgtg
gtccccatcatggcaaaggcccctcaaggggtgcatctcatctgctactcgcaggggggc
cttgtgtgccgggctctgctttctgtcatggatgatcacaatgtggattctttcatctcc
ctctcctctccacagatgggacagtatggagacacggactacttgaagtggctcttcccc
acctccatgcggtctaacctctatcggatctgctacagcccctggggccaggaattctcc
atctgcaactactggcatgatccccaccatgatgacttgtacctcaatgccagcagcttc
ctggccctgatcaatggggaaagagaccatcccaatgccacagtatggcggaagaacttt
cttcgtgtgggccacctggtgctgattgggggccctgatgatggtgttattactccctgg
cagtccagcttctttggtttctatgatgcaaatgagaccgtcctggagatggaggagcaa
ctggtttatctgcgggattcttttgggttgaagactctattggcccggggggccatagtg
aggtgtccaatggccggaatctcccacaccacctggcactccaaccgtaccctttatgag
acctgcattgaaccttggctctcctga

DBGET integrated database retrieval system